KEGG   Methanococcus maripaludis KA1: MMKA1_10830Help
Entry
MMKA1_10830       CDS       T03692                                 

Gene name
ppcA
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mmak  Methanococcus maripaludis KA1
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mmak00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MMKA1_10830 (ppcA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MMKA1_10830 (ppcA)
   00680 Methane metabolism
    MMKA1_10830 (ppcA)
Enzymes [BR:mmak01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MMKA1_10830 (ppcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1055902..1057416
Genome map
AA seq 504 aa AA seqDB search
MIPCAMATQHPDNAKRYIPVQKEPEEAIECLKDLDCDEYFVDYEGKLTPYHQTVQITLNL
LHETDLIPGKDVRITPRIPSSSEETLFRQLMALMSTIEADYKAKEVNEEAGILEVVHPMT
KSADELVGTKRWILSLLNLCNNRMGKKADDIHLIPLIEEVPELLNASKILKEYYEKCQSY
NIDIPYMRVFFGRSDPALSYGFLPAVLSVKCAISEVYDWSDEVGLDVYPIIGAGSLPFRG
HVTYENISNFVNEYKGIRTVSIQSALRYDHGPEKTRKTAKYLKEKLPKNGRLKYDDYQEL
IDFVGISTKHYLRIFYRICDKVNTVSDWLPNMRDRLSRKAPVGYARDVPKPEEIGNLCSD
EIKVELEPLKVDKLPPLPRAIKFTGALYTMGIPPEFIGTGKALEETKGEILYYYPSLKSD
LEFASHYVCIPALSSYFDKKIADELKHDLKLVEEYLDVDYGYATHTEELHWALADILASQ
NKDISEEEKNYYVQKMAEIRKSLG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgataccctgtgcaatggctacccaacatccagataatgctaaaagatatattccagtt
caaaaagaaccggaggaagctatagaatgtttaaaggatttagactgtgatgaatatttt
gtggactatgagggaaaattaactccctatcatcaaaccgttcagataacgttaaatctc
ttgcatgaaactgatttaattcctggaaaagatgttagaattaccccaagaattccatca
tcctcggaagaaacattattccgacagctcatggcattaatgtccacaattgaagcagat
tataaggcaaaagaagtaaatgaagaagcagggatattggaagtagttcatccgatgaca
aaaagtgcggatgaattagttggaacaaaaagatggatattatctctattaaacctgtgc
aataacagaatggggaaaaaagcagatgacatacatctaatccctttgatagaagaagtt
ccagaattactaaacgcttcaaaaattttaaaagaatattatgagaaatgtcagagttat
aatatcgacattccctacatgagagtatttttcggtagaagcgaccctgcattatcctat
ggatttttacctgcagtactttctgttaaatgtgcaatatcagaagtgtatgactggtct
gatgaagtgggcttagacgtatatcccataattggagctggttcattgccatttaggggc
catgtaacctatgaaaatatatctaattttgtgaatgagtataaaggtataaggaccgta
tctatacaatctgccctaagatatgaccatggtcctgaaaaaacccgtaaaactgcaaaa
tatctaaaagaaaaattaccaaaaaatggtagattaaaatatgatgactatcaagagctc
atagattttgtgggcatttccaccaaacattatctaagaatattttatagaatatgtgat
aaagtaaatactgtttccgactggctgccaaatatgagggataggctttcaagaaaagca
cctgttggctatgcaagggatgttccaaagcccgaagaaattggaaatttatgcagtgat
gaaataaaggtagaattagagcctcttaaagtagataaacttccaccactacctcgtgcc
ataaaattcaccggggcattatatactatgggtataccgccggagtttattggaactgga
aaagcccttgaagaaacaaaaggggagattctttattactatccatctctaaaatcagat
ttggaatttgcaagtcattatgtatgcattcctgcattatcgtcttatttcgataaaaaa
atagccgatgaattaaaacatgatttaaagcttgttgaagagtatcttgatgttgattat
gggtatgctacccacactgaagaattacactgggcacttgccgatatacttgcaagtcaa
aacaaggatattagtgaagaagagaaaaactattacgtgcaaaaaatggccgaaattaga
aaatcacttggataa

DBGET integrated database retrieval system