KEGG   Mycobacterium marseillense: CKJ54_17565Help
Entry
CKJ54_17565       CDS       T05049                                 

Definition
(GenBank) glycogen synthase
  KO
K16150  
glycogen synthase [EC:2.4.1.11]
Organism
mmal  Mycobacterium marseillense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CKJ54_17565
Enzymes [BR:mmal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CKJ54_17565
Glycosyltransferases [BR:mmal01003]
 Polysaccharide
  Storage polysaccharide
   CKJ54_17565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3794018..3795262
Genome map
AA seq 414 aa AA seqDB search
MRVLMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRRPTGTDPRSHPSSDQISEG
VRVIAAAQDPHEFTFGTDMMAWTLAMGHSMIRAGLNLKEPGSNNPWRPDVVHAHDWLVAH
PAIALAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSGSMAD
EITELFGPGLAEITVICNGIETERWPFAARRPRPGPAELLYLGRLEYEKGVHDVIAALPR
IRRTHPGTTLTIAGEGTQQRWLIEQARKHRVLKAIRFVGHLEHAELLAVLHRADAAVLPS
HYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGQTGVSCPPRDVTRLAAAIRRVLDDPD
AAQQRARAARERLTSDFDWHTVADKTAQVYLAAKRGERQPQARLPIVEHALPDR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgagagtcctgatggtgtcgtgggaataccccccggtggtcatcggcgggctgggccgg
cacgtccatcacctgtccaccgcgctggccgccgccggccacgacgtcgtcgtgctgtct
cgccggcccaccggaaccgatccccgcagccacccgtcctccgaccagatcagcgagggg
gtccgggtgatcgcggccgcccaggacccgcacgaattcaccttcggcaccgacatgatg
gcctggacgctcgcgatggggcattccatgatccgcgccgggctgaacctcaaggaaccc
ggcagcaacaacccgtggcgtcccgacgtcgtgcacgcccacgactggctggtggctcat
ccggcgatcgcgttggcccaattctatgacgtgccaatggtttccacgatccacgcgacc
gaggcgggtcgccattccggctgggtcagcggtgcgctcagccgccaggtgcacgcggtc
gaatcctggctggtgcgcgaatccgattcgctgatcacctgttcggggtcgatggccgac
gagatcaccgaactgttcggccccggcctggccgagatcaccgtgatctgcaacggcatc
gagacggagcggtggccgttcgcggcgcgccgaccgcggcctgggccggccgaactgctc
tacctggggcggctggagtacgagaagggggtgcacgacgtcatcgccgcgctcccccgg
atcaggcgcacccacccgggcaccacgctgaccatcgccggcgagggcactcagcagcgc
tggctgatcgagcaagcccgtaaacaccgggtgctcaaggcgattcggttcgtcggtcac
ctcgagcacgcggaattgttggcggtattgcatcgcgccgacgccgcggtgttgcccagc
cactacgagcccttcggcatcgtggcgctggaggcggccgcggccggcactcccctggtg
acgtcgaacatcggtgggctgggcgaggcggtgatcgacggtcagaccggtgtgtcgtgc
ccgccgcgggacgtgacccggctggccgcggcgatccgccgggtgctcgacgatccggac
gccgcgcaacaacgcgcgcgggccgcccgcgaacgcctcacgtccgacttcgattggcat
acggtggccgacaagaccgcgcaggtgtatctggcggccaagcgcggtgagcggcagccg
caggcacggctccccatcgtcgaacacgccttgccggaccggtag

DBGET integrated database retrieval system