KEGG   Modestobacter marinus: MODMU_2075Help
Entry
MODMU_2075        CDS       T02167                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mmar  Modestobacter marinus
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    MODMU_2075
Enzymes [BR:mmar01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MODMU_2075
DNA repair and recombination proteins [BR:mmar03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MODMU_2075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2029542..2031011
Genome map
AA seq 489 aa AA seqDB search
MAPPDPLATYRAKRDPARTAEPVPAADQPLPVGDDDTFVVQEHHTPRGRTGQRVHWDLRL
ERDGVLKSWAVPKGPPTEPGVNRLAVPTEDHPLEYASFAGTITAGEYGGGQVSIWDAGRY
ATEKWADDHVTVSFDGRRLSGRYVVFRLPDGTWNVRKLDADPVVDAPVAAGVPEDLTPML
AAIGELPRADDPRWGYEFKWDGVRALAHVRGGRVRLRARSGNDVTATYPELHRLPEVLSG
HDAVVDGEVVALDGRGRPDFGLLQGRMHRTGPEVARMAAAAPVTYLVFDLLALDGENLLG
LPYTERRERLDALGLASDRWVTTPWFRGNGEQVQAASLENGLEGVVAKRLDSVYRPGGRG
PDWRKVKNLRTQSVVVGGWRPGEGRRAGGIGSLLVGVHDDTGRLVFAGHVGTGFTARALA
DLAPLLTPRATPPFADALPREVTRDARWVEPLLVGEVRYGEWTREGRLRHPAWRGLRDDV
AAADVVVEP
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcctcccgacccgctggccacctaccgggccaagcgcgacccggcgcgcaccgcc
gagcccgtcccggccgcggaccagccgctgccggtgggcgacgacgacaccttcgtcgtc
caggagcaccacacaccccgcggccgcaccgggcagcgggtgcactgggacctgcggctc
gagcgcgacggcgtgctgaagagctgggcggtgcccaagggcccgccgaccgagccgggg
gtgaaccggctcgccgtccccaccgaggaccacccgctggagtacgcctccttcgccggc
accatcaccgccggcgagtacggcggcggccaggtgagcatctgggacgccggccgctac
gcgacggagaagtgggccgacgaccacgtcaccgtgtccttcgacgggcggcggctgagc
ggccgctacgtggtgttccggctgcccgacggcacctggaacgtgcgcaagctcgacgcc
gacccggtggtcgacgcgccggtcgcggccggcgtgccggaggacctgaccccgatgctc
gccgccatcggcgagctgccccgggccgacgacccgcgctggggctacgagttcaagtgg
gacggcgtccgggcgctcgcgcacgtgcgcggcggacgggtgcggctgcgggcccgcagc
ggcaacgacgtcaccgccacctaccccgagctgcaccggctgcccgaggtgctgtccggg
cacgacgcggtggtcgacggcgaggtggtcgcgctggacggccgcggtcgcccggacttc
gggctgctgcagggccggatgcaccgcaccgggcccgaggtggccaggatggcggcggcc
gcaccggtcacctacctggtgttcgacctgctcgcactggacggcgagaacctgctcggg
ctgccgtacaccgagcggcgcgagcggctggacgcgctggggctggcctccgaccggtgg
gtcaccacgccgtggttccgcgggaacggggagcaggtccaggcggcgagcctggagaac
gggctggagggcgtcgtcgccaagcggctggactcggtctaccggcccggcggccggggc
ccggactggcggaaggtgaagaacctgcgcacccagtcggtggtcgtcggcggctggcgg
cccggcgagggccggcgggccggcgggatcggttcgctgctggtcggggtgcacgacgac
accgggcggctggtgttcgccggccacgtcggcaccggcttcacggccagggcgctcgcc
gacctcgcgccgctgctcaccccgcgggccaccccgccgttcgccgacgcgctgccccgc
gaggtcacccgtgacgcgcggtgggtcgagccgctgctggtcggcgaggtccggtacggg
gagtggacccgggagggccggctgcggcacccggcctggcgcggcctgcgcgacgacgtc
gcagccgccgacgtggtggtggagccgtga

DBGET integrated database retrieval system