KEGG   Modestobacter marinus: MODMU_2328Help
Entry
MODMU_2328        CDS       T02167                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
mmar  Modestobacter marinus
Pathway
mmar00010  Glycolysis / Gluconeogenesis
mmar00052  Galactose metabolism
mmar01100  Metabolic pathways
mmar01110  Biosynthesis of secondary metabolites
mmar01120  Microbial metabolism in diverse environments
mmar01130  Biosynthesis of antibiotics
Module
mmar_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MODMU_2328
   00052 Galactose metabolism
    MODMU_2328
Enzymes [BR:mmar01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MODMU_2328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CCH87760
UniProt: I4EWJ7
LinkDB All DBs
Position
2290382..2291650
Genome map
AA seq 422 aa AA seqDB search
MPGRLAPPPALPPAAAAPRRRRRRWPLVATLSAGLLAGSAATPAGATDGHWGGGPGGGHA
STTVEPFGTTPDGTAVERWTLSNGDMTVRVLTYGGIVQSLEVPDARGEVDNVVLGFADLA
GYIENNNPGPYFGALIGRYGNRIANGRFELDGQTYQLPQNNNDNTLHGGTAGFDTKVWSA
TPVGDKDVAALELTLVSPDGDQGFPGTLTTTVTYSLDDDERLSVHYEATTDAPTVVNLTN
HTYWNLSGEGSGTIYDHELQLNASGYTPVDAELIPTGEIAPVAGTPFDFREPTAIGARIR
EDDQQLLYGQGYDHNWALDRVDNGTREGSDSEDALEPAARLHDPDSGRTLSIETTEPGIQ
FYSGNFLDGTLVGTGGQVYRQSDGLALETQHFPDSPNQPQFPSTVLRPGETYDSTTVFDL
SD
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcctggacgtctggcaccaccccctgccctgccgccggccgcggccgcaccccgcaga
cgacggcgccgctggccgctcgtcgccacgctcagcgccggcctgctggccggcagcgcc
gccacccccgccggggccaccgacggccactggggcggtggccccggcggcggccacgcg
agcacgacggtggagcccttcggcaccacgcccgacgggaccgcggtggagcgctggacg
ctcagcaacggtgacatgaccgtccgggtgctcacctacggcggcatcgtgcagtcgctg
gaggtcccggacgcccgcggcgaggtggacaacgtcgtcctcgggttcgccgacctggcc
ggctacatcgagaacaacaaccccggcccctacttcggcgccctcatcggccgctacggc
aaccggatcgcgaacggcaggttcgagctggacggccagacctaccagctgccgcagaac
aacaacgacaacaccctgcacggcggcacggcgggcttcgacaccaaggtctggtcggcc
accccggtcggcgacaaggacgtggccgccctcgagctgacgctggtcagcccggacggc
gaccagggcttccccggcacgctcaccacgaccgtcacctactccctcgacgacgacgag
cggctctcggtgcactacgaggccacgaccgacgccccgaccgtggtgaacctgaccaac
cacacctactggaacctgtccggcgaggggtcggggaccatctacgaccacgagctgcag
ctcaacgcgagcggctacacgccggtcgacgcggagctgatcccgaccggggagatcgca
ccggtcgccggcacgcccttcgacttccgcgagccgaccgcgatcggggcgcgcatccgg
gaggacgaccagcagctgctgtacggccagggctacgaccacaactgggcgctggaccgg
gtggacaacgggacgcgggagggctcggacagcgaggacgcgctcgagcccgcggcccgg
ctgcacgacccggacagcggccggacgctgtcgatcgagaccaccgagccgggcatccag
ttctactcgggcaacttcctggacggcacgctggtcgggaccggcggccaggtgtaccgg
cagagcgacgggctggccctggagacccagcacttcccggactccccgaaccagccgcag
ttcccctcgaccgtgctgcgcccgggggagacctacgacagcaccacggtgttcgacctg
tccgactga

DBGET integrated database retrieval system