KEGG   Modestobacter marinus: MODMU_4568Help
Entry
MODMU_4568        CDS       T02167                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate decarboxylase
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mmar  Modestobacter marinus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmar00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MODMU_4568 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    MODMU_4568 (sucA)
   00380 Tryptophan metabolism
    MODMU_4568 (sucA)
Enzymes [BR:mmar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     MODMU_4568 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4565603..4569430
Genome map
AA seq 1275 aa AA seqDB search
MSSSQPSSASANPVAGFGTNEWLVEEMYQQYLADPRSVDQAWHDFFADYRPGSPVSDGAD
RSSQTAPAPEQPAPAPAPAAAKPAAAASKPAASKPAAPKPTPAATATPAPRATPVDARSE
GTVVNRAAERASQQVPAAPAKPSPGAGAARAAGDDAGSGPKRTPLRGAAASVVKNMNASL
TVPTATSVRAVPAKLLVDNRIVINNHLARARGGKVSFTHLIGYALVRALDSFPNMNTAFA
EVDGKPTLVTPEHVNFGLAIDLPKADGTRSLVVASIKSAEQMDFAEFWGAYEDIIRRARA
GKLTMEDFSGTTISLTNPGTIGTNHSVPRLTTNQGTIVGVGAMDYPAEFQGMSPEALAEM
AVSKIITLTSTYDHRVIQGAESGDFLRRMHQLLLGEDGFYDDVFRSLRVPYEPVRWVADK
RVSHEGQIDKEARVIEVIEAYRRNGHLMADTDPLEFKVRTHPDLDIVQHGLTLWDLDRPF
PVGGFAGERTMPLRDILGVLRNSYCRTVGIEYMHITDPEERGWLQQRIEVKHDQPTRDKQ
KRVLGRLNAAEAFETFLQTKYVGQKRFSLEGGESVIPLLDEVLVASTEYGLEEVAIGMAH
RGRLNVLANVLGKSYSKIFGEFEGNIDPGTVQGSGDVKYHLGAEGTFEHDGRSIAVSLAS
NPSHLETVNPVLEGIVRAKQDMIDKGEGGFTVLPVLLHGDSAFAGQGVVQETLNLSQLRG
YRTGGTVHVVINNQVGFTTSPAAARSSLYSTDVARMIGAPVFHVNGDDPEACVRVAKLAV
DYRQAFKKDVVIDLVCYRRRGHNEGDDPSMTQPLMYDIIDRKRSVRKLYTEALVGRGDIT
LADAEEALKDYRGQLERAFAETHDARDSSTPEPVMDPRSPQQATVDTAISPEVLKTIGDA
HVSFPPDFTPHPKLQKMLERRAAMASEGGIDWAMGELLAFGSLLMQGVPVRLAGQDSRRG
TFVQRHSVLIDRENAAEYTPLSNLTPDQAKFFVYDSLLSEYAALGFEYGYSVANPKALVL
WEAQFGDFVDGAQMVIDEFISSGEAKWGQRSGVVMLLPHGLEGQGPDHSSGRIERFLQLS
AENNMTVANCSTPANYFHLLRRQALSEVHRPLVVFTPKSLLRAKAAVSPVADFTEQHFRP
VLPDPGVGRKALDGASVKRVLLCSGKVSYELFSQREAEGRTDTAVLRVEQLYPLPAEEIV
EALAQYPNASDVVWVQEEPANMGAAQFMLVNLPDELPAGRTLRRVSRKASASPAVGSAKV
HEVEQRALVAQAFAD
NT seq 3828 nt NT seq  +upstreamnt  +downstreamnt
gtgagctcatcccagccctcctccgcctctgccaacccggtggcgggattcggcaccaac
gagtggctggtcgaggagatgtaccagcagtacctggccgacccgcgcagcgtcgaccag
gcctggcacgacttcttcgccgactaccgcccgggcagtccggtgtccgacggcgcagac
cgcagctcgcagaccgccccggccccggagcagcccgcaccggcaccggcacctgccgcg
gcgaagccggccgccgccgcctcgaagccggccgcctcgaagccggccgcaccgaagccg
acccccgcggccaccgccaccccagcgccgcgggccaccccggtcgacgcccgatcggag
ggcaccgtcgtgaaccgagcagccgagcgcgcctcccagcaggtgcccgccgccccggcg
aagccgtcccccggcgcgggcgccgcccgagcagccggcgacgacgccggctccggcccc
aagcgcaccccgctgcgcggcgccgcggcgagcgtggtcaagaacatgaacgcgtcgctg
accgtcccgacggcgaccagcgtgcgcgccgtcccggccaagctgctcgtggacaaccgc
atcgtcatcaacaaccacctggcccgcgcccgcggcggcaaggtgtccttcacgcacctg
atcggctacgcgctggtccgggcgctggacagcttcccgaacatgaacaccgcgttcgcc
gaggtcgacggcaagccgaccctggtgacgccggagcacgtcaacttcggcctggcgatc
gacctgcccaaggccgacggcacccgctcgctggtggtcgcctcgatcaagtccgccgag
cagatggacttcgccgagttctggggcgcctacgaggacatcatccggcgggcccgcgcc
ggcaagctgaccatggaggacttctccgggacgacgatcagcctgaccaacccgggcacg
atcggcaccaaccactcggtgccccggctgaccaccaaccagggcacgatcgtcggcgtc
ggcgcgatggactacccggccgagttccaggggatgagccccgaggcgctggccgagatg
gccgtctcgaagatcatcacgctcacctcgacctacgaccaccgggtcatccagggtgcg
gagtccggcgacttcctgcgccggatgcaccagctgctgctgggcgaggacggcttctac
gacgacgtcttccgctcgctgcgggtgccctacgagccggtccgctgggtggccgacaag
cgggtcagccacgaggggcagatcgacaaggaagcccgggtcatcgaggtcatcgaggcc
taccggcgcaacggccacctgatggccgacaccgacccgctggagttcaaggtccgcacc
caccccgacctggacatcgtccagcacgggctgacgctgtgggacctcgaccggcccttc
ccggtcggcggcttcgccggtgagcgcaccatgccgctgcgcgacatcctcggcgtgctg
cgcaactcctactgccgcacggtcggcatcgagtacatgcacatcaccgaccccgaggag
cgcggctggctgcagcagcgcatcgaggtcaagcacgaccagcccacccgggacaagcag
aagcgggtgctcggccggctcaacgccgccgaggcgttcgagaccttcctgcagaccaag
tacgtcgggcagaagcggttcagcctcgagggcggcgagtcggtgatcccgctgctggac
gaggtgctggtggcctccaccgagtacggcctggaggaggtcgcgatcggcatggcccac
cgcggccggctgaacgtgctcgccaacgtgctgggcaagagctactcgaagatcttcggg
gagttcgagggcaacatcgacccgggcaccgtgcagggctccggcgacgtcaagtaccac
ctgggcgccgagggcaccttcgagcacgacggccgctcgatcgccgtctcgctggccagc
aaccccagccacctggagacggtcaacccggtgctcgagggcatcgtgcgggccaagcag
gacatgatcgacaaaggcgagggcggcttcaccgtgctcccggtcctgctgcacggcgac
tccgcgttcgccggccagggcgtggtgcaggagacgctgaacctctcccagctgcgcggc
taccgcaccggcggcacggtgcacgtggtcatcaacaaccaggtcggcttcaccaccagc
ccggccgcggcgcgctcgagcctctactcgaccgacgtcgcgcggatgatcggcgcgccg
gtcttccacgtgaacggcgacgaccccgaggcctgcgtccgggtggccaagctggcggtc
gactaccggcaggcgttcaagaaggacgtcgtcatcgacctggtctgctaccgccgccgc
gggcacaacgagggcgacgacccgtcgatgacccagccgctgatgtacgacatcatcgac
cgcaagcgctcggtccggaagctgtacaccgaggcgctggtcggtcgcggcgacatcacg
ctggccgacgccgaggaggccctgaaggactaccgcgggcaactggagcgggccttcgcc
gagacgcacgacgcccgggactcctccacgcccgagccggtcatggacccgcgctcgccg
cagcaggcgaccgtggacaccgcgatcagcccggaggtcctcaagaccatcggcgacgcc
cacgtcagcttcccgccggacttcaccccgcacccgaagctgcagaagatgctcgagcgc
cgggccgcgatggccagcgagggcggcatcgactgggcgatgggcgagctgctggccttc
ggctcgctgctcatgcagggcgtcccggtgcggctggccggccaggactcccgccgcggc
accttcgtgcagcgccactcggtcctcatcgaccgggagaacgccgccgagtacacgccg
ctgtcgaacctgacccccgaccaggcgaagttcttcgtctacgactcgctgctcagcgag
tacgccgcgctcggcttcgagtacggctactcggtggccaaccccaaggcgctggtcctc
tgggaggcgcagttcggcgacttcgtcgacggcgcgcagatggtgatcgacgagttcatc
agctccggcgaggccaagtgggggcagcggtccggcgtggtcatgctgctgccgcacggc
ctcgagggccagggcccggaccactccagcggccggatcgagcggttcctgcagctgtcc
gccgagaacaacatgaccgtcgccaactgctccaccccggcgaactacttccacctgctg
cgccgccaggcgctctcggaggtgcaccgcccgctggtggtgttcacgcccaagtcgctg
ctgcgggccaaggcggcggtcagcccggtcgccgacttcaccgagcagcacttccgcccg
gtcctgcccgacccgggtgtcggccgcaaggcgctggacggcgcctcggtcaagcgggtg
ctgctgtgcagcggcaaggtcagctacgagctcttctcccagcgggaggccgagggccgc
accgacaccgccgtcctgcgggtcgagcagctgtacccgctgccggccgaggagatcgtc
gaggcgctggcgcagtaccccaacgcctcggacgtcgtgtgggtgcaggaggagccggcg
aacatgggtgccgcccagttcatgctggtcaacctgcccgacgagctgcccgccggccgc
accctgcgccgggtctcgcgcaaggcctcggccagcccggccgtcgggtcggcgaaggtg
cacgaggtcgagcagcgcgccctggtggcccaggccttcgcggactga

DBGET integrated database retrieval system