KEGG   Myxococcus macrosporus: MYMAC_005641Help
Entry
MYMAC_005641      CDS       T05096                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mmas  Myxococcus macrosporus
Brite
Enzymes [BR:mmas01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MYMAC_005641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Phage_T4_gp36 FlgD_ig
Motif
Other DBs
NCBI-ProteinID: ATB49987
UniProt: A0A250K2K8
LinkDB All DBs
Position
7073515..7074087
Genome map
AA seq 190 aa AA seqDB search
MKIRALLTAAALTAALPALAQENAGTPPAKGTAPATDKKTPPKHQTAKAQVKDSQGKDVG
DITLEQTKQGILIKGKLSNLPPGQHAFHIHEVGKCEAPGFTTAGGHFNPTKKAHGLLAPK
GKHHGDLPNLYVAKDGTVQFDIFSQNGLTVKSLFDKDGSAVVIHAQEDDYHTDPTGDAGG
RIACGVVEKT
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcgagccctgctcaccgccgccgcactgaccgccgccctccccgccctggct
caggagaacgcgggcacgccgccggccaagggcaccgcgccggcgacggacaagaagacg
ccgcccaagcaccagacggccaaggcccaggtgaaggactcccagggcaaggacgtgggc
gacatcaccctggagcagaccaagcagggcatcctcatcaagggcaagctgagcaacctg
ccgccgggccagcacgccttccacatccacgaggtgggcaagtgcgaggcgcccggcttc
accacggcgggcggccacttcaaccccacgaagaaggcccacggcctgctggcgcccaag
ggcaagcaccacggcgacctgcccaacctctacgtggcgaaggacggcacggtgcagttc
gacatcttttcgcagaacggcctcaccgtgaagtcgctgttcgacaaggacggctccgcg
gtggtcatccacgcccaggaggacgactaccacaccgacccgacgggcgacgccggtggc
cgcatcgcctgcggcgtggtggagaagacgtag

DBGET integrated database retrieval system