KEGG   Myxococcus macrosporus: MYMAC_006327Help
Entry
MYMAC_006327      CDS       T05096                                 

Definition
(GenBank) AMP-dependent synthetase
Organism
mmas  Myxococcus macrosporus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ATB50671
UniProt: A0A250K4Y0
LinkDB All DBs
Position
complement(7890901..7892679)
Genome map
AA seq 592 aa AA seqDB search
MTDAGSRLVGPALPARRHATVNAALAATGTTSPLGLTFVDAAEREVSLPWAEVYRRAKRT
AAGLARLGVREGDRVALLLPTSPAFMDAFFGTLLAGAVPVPLYPPVRLGRLEEYHRATSR
MLHVTGAVMVLTDSRVRLLLGPSVERARPRLGCHTVDEVSKGDDVLEAAVRPGALGLIQF
SSGSTVDPKPVTLTHEALLAQVAALEVEMPLGPDVPRVGVSWLPLYHDMGLIGCLLAALY
YPGSLVLIPPEVFLARPSLWLRALSRHRAYISPAPNFAYGLCLKRVRDSELEGVDLSSWR
HALNGAEPVSADTLRRFARRFERWGFSARALRPVYGLSEASLAVTFPPAGRGPRALGVDA
ALLAREGRVAEGSRELVSVGRPVAGFEVEVRGEAGEPLAERHVGRVFARGPSLMSGYFAD
AQATDRTLTRDGWLDTGDLGFLADGELYLTGRAKDVVIIRGANHAPQAFEEPLQNVEGVR
TGCAVALGFTPEGGEDEALLILAERAGDEADDVVEQRIRTVVVEATGVRPHTVRLLEPGT
LPRTSSGKLRRAEALRRYLAEALAPPKKVGAVGLAVEMAKSALAMVRAERDT
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacgcgggctcgcggctggtggggccggcgctgccggctcggaggcacgccacg
gtgaacgcggcgctcgcggccacgggcaccacgtccccgctgggcctcaccttcgtggac
gcggccgagcgcgaggtgtccctgccctgggcggaggtgtaccgccgggcgaagcggacc
gcggcggggctggcgcggctgggcgtgcgcgagggcgaccgggtggccttgctgctgccc
acgtcgccggccttcatggacgccttcttcggcacgttgctggcgggcgcggtgccggtg
ccgctgtacccgcccgtgcggctggggcgcctggaggagtaccaccgcgccacctcgcgg
atgctccacgtgacgggcgcggtgatggtgctgacggacagccgggtgcggctgctgctg
gggcccagcgtggagcgcgcgcgtccccggctgggctgtcacacggtggacgaggtgtcc
aagggcgatgacgtgctggaggccgccgtgcggcccggcgcgctggggctcatccagttc
tcctccggctccacggtggacccgaagccggtgacgctgacgcacgaggcgctgctggcg
caggtcgcggcgctggaggtggagatgccgctggggccggacgtgccccgggtgggcgtg
agctggctgccgctgtaccacgacatggggctcatcggctgtctgctggccgcgctgtac
tacccgggcagcctggtgctgattccgcccgaggtcttcctcgcgcggccctcgctgtgg
ctgcgcgcgctgtcacggcaccgggcctacatctcgcccgcgcccaacttcgcctatggg
ctgtgcttgaagcgggtgagggactcggagctggagggcgtggacctgtcgtcgtggcgg
cacgcgctcaacggcgcggagccggtttccgcggacacgctgcgccgcttcgcgcggcgc
ttcgagcggtggggcttctccgcgcgggcgctgcgtccggtgtacgggctgtccgaggcg
tcgctcgccgtcaccttcccgccggcgggccgggggcctcgcgcgctgggggtggacgcg
gcgctgctggcccgggagggccgggtggcggagggctcgcgcgagctggtgagcgtgggc
aggccggtggcgggcttcgaggtggaggtgcgcggcgaggcgggcgagccgctcgcggag
cgacacgtgggccgggtcttcgcgcgggggccgtcgctcatgtccggctacttcgcggac
gcgcaggccacggaccggacgctgacgcgggacgggtggctggacaccggagatttgggc
ttcctcgcggacggtgagctgtacctcacgggccgggcgaaggacgtggtcatcatccgc
ggggcgaaccacgcgccccaggccttcgaggagccgctgcagaacgtggagggcgtgcgc
acgggctgcgcggtggcgctcggcttcacgcccgagggcggcgaggacgaggcgctcctc
atcctggctgagcgcgcaggggacgaggcggatgacgtggtcgagcagcgcatccgcacc
gtggtggtggaggccacgggcgtgcggcctcacaccgtgcggctgctggagccggggacg
ttgccgcgcacgtccagcggcaagctgcgccgcgccgaggcgctgcggcgctatctggcg
gaagcgctggcgccgccgaagaaggtgggcgcggtggggctcgcggtggagatggccaag
agcgcgctggcgatggttcgcgcggagcgcgacacctga

DBGET integrated database retrieval system