KEGG   Methanosarcina mazei Tuc01: MmTuc01_0886Help
Entry
MmTuc01_0886      CDS       T02477                                 

Definition
(GenBank) Alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mmaz  Methanosarcina mazei Tuc01
Pathway
mmaz00500  Starch and sucrose metabolism
mmaz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmaz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MmTuc01_0886
Enzymes [BR:mmaz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MmTuc01_0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57
Motif
Other DBs
NCBI-ProteinID: AGF96288
UniProt: M1Q7Y4
LinkDB All DBs
Position
851457..852593
Genome map
AA seq 378 aa AA seqDB search
MKAVCMCVGVHLPYSPKWYWPVEGFTGVPEMDRYFDRNQIFSRLLKAGREFLRLNDLFIE
SIERGGSYAFDLSGPFLEQCRWDPEMLESFRELAESRRVEFTGSCNYHSLSALYPDLSWF
REEVTIYREMMKELLGVSPETFVNTELLYTQRAGDILGEMGFKCLIAEGSRNILDGYDPV
RVFESQLPILLRHINLSEDLELRFSEKSWEGYPLIPDKFADWIAGIEGDVLTLYLNNTSL
CLHHRNKSMIADFIRAFPEALKSRGIEMITPSEAVSRFSPLRLPTLGTEQTIRYGMHNAV
GNHAQQLYLRELVRVGEELSEIKGKKNYGRLKQIFGYLQQSEILFSMGPGNSREGHERAV
NYYSILSDLRRAVLEESA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtttgcatgtgtgtgggagtgcatcttccttacagcccgaaatggtactgg
cctgtagagggttttaccggagtgcctgagatggacaggtattttgaccggaaccagata
ttttcaaggcttctaaaagcaggtagagagtttttgcgccttaatgatctttttatagaa
tcaattgaaagagggggaagttatgcttttgatctttcaggtcctttccttgaacagtgc
agatgggaccctgagatgcttgaatctttcagggaacttgcggaaagcaggagagtagag
tttacagggagctgcaactaccattccctgagtgccctttatcccgacctctcctggttc
agggaagaagtaacaatatacagggaaatgatgaaggagcttttgggagtaagccctgag
actttcgtaaacaccgaactcctgtacactcagagagcaggcgacatacttggcgagatg
ggcttcaaatgtcttattgccgaagggtcaagaaatattctggacggatatgaccctgtc
cgcgtctttgagagccagcttcccattcttctcagacacataaacctgagtgaagacctg
gaactgcgcttttcggaaaaaagctgggaaggatatcctcttatccctgacaaattcgca
gactggattgcaggaattgaaggagatgtcctgaccctctatttgaacaatacgagcctc
tgccttcaccacaggaacaagagcatgatagctgattttataagggcttttccggaagcc
cttaaaagccggggcattgagatgatcacgccttctgaagccgtaagcaggttcagtcct
ttaaggcttccgactctggggacagaacagacaatccgttatggaatgcacaatgccgtc
ggaaaccatgctcagcagctttacctgagggagcttgtaagggtaggggaagaactttca
gaaattaaaggaaaaaagaactacggaaggctcaaacagatatttggctacctccagcaa
agcgaaatccttttttcaatgggacccggaaactcacgggaaggccatgaaagggctgtg
aactattattccattctttcggacctgagaagggctgttctggaggaaagcgcatga

DBGET integrated database retrieval system