KEGG   Martelella mediterranea: Mame_02366Help
Entry
Mame_02366        CDS       T04757                                 

Gene name
tuf_1
Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
mmed  Martelella mediterranea
Brite
Translation factors [BR:mmed03012]
 Eukaryotic Type
  Elongation factors
   Mame_02366 (tuf_1)
 Prokaryotic Type
   Mame_02366 (tuf_1)
Mitochondrial biogenesis [BR:mmed03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Mame_02366 (tuf_1)
Exosome [BR:mmed04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Mame_02366 (tuf_1)
  Exosomal proteins of breast cancer cells
   Mame_02366 (tuf_1)
  Exosomal proteins of colorectal cancer cells
   Mame_02366 (tuf_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AQZ51695
UniProt: A0A1U9Z1X5
LinkDB All DBs
Position
2546334..2547509
Genome map
AA seq 391 aa AA seqDB search
MAKAKFERSKPHVNIGTIGHVDHGKTSLTAAITKYFGDFRAYDQIDAAPEEKARGITIST
AHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDEELLELVEMEVRELLDSYEFPGDEIPIIKGSALAALEDSDKK
IGEDAVRELMAAVDDYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIKDTQKTTVTGVEMFRKLLDQGQAGDNIGALIRGVQRDQVERGQILCKPGSVTPHT
VFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIIK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagcaaagtttgagcggagcaagccgcacgtaaacatcggcacgatcggccac
gttgaccatggcaagacgtcgctgacggcagcgatcacgaagtatttcggcgatttccgc
gcgtatgaccagatcgacgcggctccggaagaaaaggctcgcggcatcaccatctcgacc
gcgcacgtcgagtatgagaccgacaagcgtcactacgcccacgtcgactgccccggccac
gccgactatgtgaagaacatgatcaccggtgctgcccagatggacggcgcgatcctggtc
gtgtccgccgccgacggcccgatgccgcagacccgcgagcacatcctgcttgcccgtcag
gttggcgttccggcgatcgtcgtgttcctgaacaaggtcgaccaggtcgatgacgaagag
ctgctcgagctcgtcgaaatggaagtccgcgaactgctcgactcttacgagttccccggc
gacgaaatcccgatcatcaagggttcggctctcgccgctctcgaagattcggacaagaag
atcggcgaagacgccgttcgcgaactgatggccgccgtcgacgactacatcccgacgccc
gagcgtccgatcgaccagcccttcctgatgccgatcgaagacgtgttctcgatctcgggt
cgcggtacggttgttaccggtcgcgtcgagcgcggcatcgtcaaggttggcgaggaagtc
gagatcgtcggcatcaaggacacccagaagacgacggttaccggcgttgagatgttccgc
aagctgctcgaccagggccaggccggcgacaatatcggcgcgcttatccgcggcgttcag
cgcgatcaggtcgagcgcggccagatcctctgcaagcccggttcggttaccccgcacacc
gtgttcaaggcagaagcctacattctgacgaaggacgaaggcggccgtcatacgccgttc
ttcaccaactatcgtccgcagttctacttccgcaccacggacgtgaccggtgttgtcacg
ctgccggaaggcacggaaatggttatgccgggcgacaacgtcacggttgacgtcgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgcgatccgcgaaggcggccgcacg
gttggtgcagggattgttgcttcgatcatcaagtaa

DBGET integrated database retrieval system