KEGG   Methanohalophilus mahii: Mmah_0013Help
Entry
Mmah_0013         CDS       T01211                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mmh  Methanohalophilus mahii
Brite
Enzymes [BR:mmh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mmah_0013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ADE35551
JGI: Mmah_0013
UniProt: D5E8P2
LinkDB All DBs
Position
complement(13001..14167)
Genome map
AA seq 388 aa AA seqDB search
MKGSEKPELDMEKTARFLGLSVSRLERLLEKRLLSRNWGKYKNLFRFETSVSGIERGSVL
LQKRDGELDLILGFPKIQRAMLLEPSINNHFSEIDKLIVEEKMNGYNVRVIENAGKLIAF
TRSGHVCPYSTEKVNYLLDPSFFRQYPDLVVHGEMAGPENPYVSKKVYDTQTLDFFVFDI
RHKKTGQPLPVIQRRKLAASFGFKQVPFLGEFARKEAAEKIMSIIKKLGDMGHEGVVIKD
LDMDLSPIKYTCSESNCADLEHAFKFYNEVGRDYLYSRVVREGFQTVEWDEDEDTMEKRC
LRLGKSILSPMADSVRRVGNGEKLYDEVTLRFQNPQTLQEFEEYFRRLGIDAIFDRVGYS
GGELMVNLQKLNQSTTDKTESMWEGNLW
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttcggagaaaccagaacttgatatggaaaagacagcccgctttttagggctg
tcagtctccagactggaaagactacttgaaaaaagactcctgtcaagaaactggggaaag
tacaagaatttgttcaggtttgaaacctccgtctcgggtatagaaagaggaagtgtcctc
ctgcaaaaacgcgatggagaactggatttaatcctgggtttcccgaaaatacagcgcgca
atgctgcttgagccttccataaataaccatttttcagaaattgataaactcatagtcgaa
gaaaagatgaacggctataatgtccgtgtaattgaaaacgcagggaaacttatcgctttt
acacgcagtgggcatgtctgtccctattccacagaaaaagtcaattatcttttagacccc
tcctttttcagacaatatcctgatcttgtagtgcacggggaaatggcaggccccgagaat
ccttatgtctccaaaaaggtctacgatacacagacactggattttttcgtcttcgatata
cgccacaaaaagactggacagcccctgccggtcatacaaagaagaaaactggccgcatcc
tttggttttaagcaggttcctttcctgggagagtttgcaaggaaagaggctgctgaaaag
atcatgtccatcataaaaaaactgggggatatgggacatgaaggggtggtcatcaaggat
ttggatatggatctgtcacctatcaaatatacatgttcagagagtaattgcgccgacctt
gaacatgctttcaagttctataatgaagtggggcgggattatctgtattccagggtagtc
agggaaggtttccagaccgtggaatgggatgaggatgaagacacaatggagaaacggtgc
ttaaggcttggcaaaagcatcctctctcctatggccgattctgttcgaagggttggcaac
ggtgaaaaactctatgatgaggttacattgcgtttccagaatccacaaaccctgcaggaa
tttgaggaatatttccgacgacttggcatagatgctatttttgaccgggttggatattca
ggaggagaacttatggtaaacctacaaaaactcaaccagagtaccaccgacaagaccgaa
tcaatgtgggaaggcaacctgtggtga

DBGET integrated database retrieval system