KEGG   Mycobacterium marinum M: MMAR_1170Help
Entry
MMAR_1170         CDS       T00694                                 

Gene name
fadD29_1
Definition
(GenBank) fatty-acid-CoA ligase FadD29_1
Organism
mmi  Mycobacterium marinum M
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1405360..1407351
Genome map
AA seq 663 aa AA seqDB search
MSRPTAKDRTAAEAVMCAIQTNPATDAVRFLPRGEGPGTVISYEGLHARAARLAAALQAR
GAQGERVILASRDNIEMTVGLVACLYSGAVAVPVPVPNMNKSGPALLRLQAIARDAQARV
FLTDLPSVDSQSNVRTLPEGLSGLIWLNTDDASADRADWQPPRYAPESAALLQYTSGSTG
QPKGVMLTQANLLSNAHQIERRWEQDQNELLVSWLPQYHDFGLIFMALQALYLGATVVSM
PPSAFVQDPLRWLRCLTQYRGTNSGAPNFAFDLCVEQSTPAQREGLDLRSVKALNCGAEP
VRAETMRRFLAAFAPFGLRPDALRPGYGLAEATLFVTGWRGPTVKTLTLDQRQLNEGRVV
ECDIAATPLTEVVCCGPAGPEVELAIVSTQTQQPCAADEVGEIWVRGPNISRGYFNGAGA
SQDCFGNVAGQGQYLRTGDLGFVQDGDLYVTGRLKDLVIVRGVNHYPQDIEFSVEQSHPA
IRPGYCAAFTLEVDGEERLGVAAEIAADDPAQDTLESAMDSILQAITSHHEVVPYRLVLL
ARGAIPKTSSGKIQRQLCKQLLLTDQLPILGDRVSTATISSTPQQPDGGARSPKYRAMEQ
YLLELLNLSPEELESGNNLAAYGFDSIDGAALAKKIKADWGIEVPMEILPLLTIRDLVDT
LAN
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagaccgacagccaaagatcggacggccgccgaggccgtcatgtgcgccatacag
accaacccggccaccgacgcggtgcgctttctgccccgaggcgaggggcctggcacggtg
atcagctacgaagggctgcacgcgcgcgccgcccgtctggcggcggcgctgcaggcgcgg
ggggcgcaaggcgagcgggtgatcctggccagtcgcgacaacatcgagatgacagtgggg
ctggtcgcctgcctgtacagcggcgcggtagcggtgccggtgccggtgccgaatatgaac
aagtcggggccggcattgctgcgactgcaggccattgcgcgagatgcgcaggcgcgagtc
ttcttgaccgacctgccgtcggtggactctcaatcaaacgttcgcaccctgcccgaaggg
ctttcggggctgatctggctgaacaccgacgacgccagcgccgaccgggccgactggcaa
cccccgcggtatgcgcccgagagcgcggcgctgctgcagtacacctctggctcgaccgga
cagcccaaaggggtgatgctcacccaggccaacttgctgtccaatgcccatcagatcgag
cggcgttgggaacaagaccaaaatgagttgcttgtctcctggctccctcagtatcacgac
tttgggttgatcttcatggcgctacaagcgctctatctgggggccacggtggtttcgatg
cccccgtccgcctttgtgcaggatccgctgcgttggcttcgctgcctcacccagtaccgc
ggtaccaacagcggcgcgcccaacttcgccttcgatctctgcgtggagcaaagcacgcca
gctcagcgcgaggggctggatctgcgtagcgtcaaggcgttgaactgcggcgctgagccg
gtgcgggcggagacgatgcgccgtttcctggccgcgtttgccccgttcgggctgcggccg
gatgcccttcggcccggttacggtctggccgaagccacgttgttcgtgaccggctggcgc
gggcccacagtcaagacattgacgctggaccagcgccagctcaacgagggccgggtcgtg
gaatgtgacattgccgcaacgcctttgacggaggttgtctgctgcggtccggcgggtcca
gaagtggagctggccattgtctcgacgcagacacaacagccatgcgctgccgacgaagtg
ggcgagatctgggtgcgggggcccaatatcagccggggatacttcaacggtgccggcgca
agccaagactgctttggcaacgtcgcgggccaaggacagtacttgcgtacgggcgacctg
ggttttgtgcaagatggcgacctgtacgtgacgggtcggctgaaggacctggtgatcgtg
cgcggagtcaaccactacccgcaagacatcgaattctcggtcgagcaatcccaccccgcg
atccggcccggatactgcgccgccttcacgctggaggtcgatggtgaagagcgactgggc
gtcgccgcggaaatcgcggcagacgatccagcgcaagacaccctggaaagtgcgatggac
tcgattcttcaggccatcaccagccaccacgaggtggtgccctaccggctggttctcttg
gcccgcggcgccattcccaagacgtccagtggcaagatccagcggcaactgtgcaaacag
ctgctgttgaccgatcagctgccgattctcggcgaccgtgtcagtaccgcgacgatatcg
tcgacgccgcagcaacctgatggtggcgcgcgatcgccaaagtatcgcgcgatggagcag
tacctcctcgagctgttgaatctgagccccgaagaactggagagcggcaacaatctagcc
gcctatggttttgattccatcgatggcgcagctttggctaagaaaataaaggccgactgg
ggcattgaagtcccgatggaaatattgccgctcctgaccatcagagatctcgtggatacg
ctcgccaactaa

DBGET integrated database retrieval system