KEGG   Mycobacterium microti: RN08_3289Help
Entry
RN08_3289         CDS       T04291                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mmic  Mycobacterium microti
Pathway
mmic00473  D-Alanine metabolism
mmic00550  Peptidoglycan biosynthesis
mmic01100  Metabolic pathways
mmic01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mmic00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    RN08_3289
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RN08_3289
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    RN08_3289
Enzymes [BR:mmic01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RN08_3289
Peptidoglycan biosynthesis and degradation proteins [BR:mmic01011]
 Precursor biosynthesis
  Amino acid ligase
   RN08_3289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 RimK ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AMC60716
UniProt: A0A120IY47
LinkDB All DBs
Position
complement(3328843..3329919)
Genome map
AA seq 358 aa AA seqDB search
MFGGRSNEHAISCVSAGSILRNLDSRRFDVIAVGITPAGSWVLTDANPDALTITNRELPQ
VKSGSGTELALPADPRRGGQLVSLPPGAGEVLESVDVVFPVLHGPYGEDGTIQGLLELAG
VPYVGAGVLASAVGMDKEFTKKLLAADGLPVGAYAVLRPPRSTLHRQECERLGLPVFVKP
ARGGSSIGVSRVSSWDQLPAAVARARRHDPKVIVEAAISGRELECGVLEMPDGTLEASTL
GEIRVAGVRGREDSFYDFATKYLDDAAELDVPAKVDDQVAEAIRQLAIRAFAAIDCRGLA
RVDFFLTDDGPVINEINTMPGFTTISMYPRMWAASGVDYPTLLATMIETALARGVGLH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgttcggcgggcgcagcaacgagcacgccatctcgtgtgtgtccgccggcagcatcctg
cgcaacctggactcgcggcggttcgacgtgatcgcggtgggtatcaccccggcaggttcg
tgggtgctcaccgacgccaaccccgacgccctgacgatcaccaaccgggagcttcctcag
gtcaaatcaggatcgggcaccgagctggcgctgccggccgatccgcggcgtggtggccag
ttggtgtcgctgccgcccggggccggcgaggttctggagtcggtcgacgtggtgttcccg
gtactgcacggcccgtacggcgaggacggcacgatccagggactgctcgaactcgccggg
gtgccctacgtgggcgccggtgtgctggccagtgccgtcggcatggacaaggagttcacc
aagaagctgctcgccgccgatggacttccggtgggtgcgtacgcggtgctgcgtccgccg
cggtcgacactgcaccgccaggagtgcgaacggctgggcttaccggtgttcgtcaaaccc
gcccgaggcggctcgtcgatcggtgttagccgggtgtcgagttgggatcaactgcccgcc
gcggtcgcgcgggcccgccggcatgaccctaaggtcatcgtcgaggccgcgatcagcggc
cgcgagctggaatgcggtgtgctcgaaatgccggacggcacactggaagccagcacgctg
ggggagatccgggtggccggggtgcggggacgcgaggactctttctacgacttcgcaacc
aagtatctcgacgacgcagccgaattggacgtgcccgccaaggtcgatgaccaggtcgca
gaggcgattcgtcagctggcgatccgggcgttcgcggctatcgactgccggggtctggcc
agggtggacttcttcctcaccgacgacggtccggtgatcaacgagatcaacacgatgccg
ggattcaccacgatctcgatgtacccgcggatgtgggcggccagcggtgtcgactatccg
accctgctggcgacgatgatcgagacggcattggcccgcggcgtgggcctgcactag

DBGET integrated database retrieval system