KEGG   Methanosarcina mazei S-6: MSMAS_1474Help
Entry
MSMAS_1474        CDS       T04532                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, archaeal
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mmj  Methanosarcina mazei S-6
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mmj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSMAS_1474
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MSMAS_1474
   00680 Methane metabolism
    MSMAS_1474
Enzymes [BR:mmj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MSMAS_1474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1809474..1811054
Genome map
AA seq 526 aa AA seqDB search
MSKKATYPKVMCTQHPDSASKYISTQEEPGEAIEAAVVFGCDEYMPDYEGKATPYHQNVQ
IVSRFIEETDLIPGKDIFITPRAPSAAQENRFRQLMVMMSIAEANHGALEYSDVQAINEF
VHPMTGTVGEILDAQQHMVDVGELAKKEFGVAMEVPRIIPLIEDAPALLHAKELAENTLL
SWEKRFGAAPEKFRVFLGKSDSALSFGHVASTLSCKYAISGISEMDLELDTSTGIIFGAG
TLPFRGHLSLKNAENFFREYRGIGTITLQSALRYSHDKGEAEALVRLAEERLPESPEIYS
GEEKEEIVNLIGIFGARYNRIIREMSCTINQLAGLLPQQRDRLMHKGTGGYSRNVPDISG
LVCLCRKDVGKELSASMPAEDLNLPRAIKFTGALYSIGLPPEFIGTGTALEEAREKLGEE
SCERLLKKYFPSLASDLSFASGYLDLNVASRFLPEACLKEIRKDVEVLRDTFSLKVQPEP
SYRILLEMMQPDLLQAGTKGNCMDEEVSQLVCSTLTKMGKIRKALG
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaagcaacctatccgaaagtaatgtgcacgcagcacccggactctgcatca
aaatatatctccacgcaggaagaacccggtgaagccattgaagctgcggtggtattcggc
tgtgacgaatatatgccggattatgaagggaaggcaactccttaccaccagaacgtccag
atagtatccagattcatagaagaaacggaccttatacccggaaaagacattttcattact
ccgcgtgctccgagcgcagctcaggaaaaccggttcaggcagcttatggtcatgatgtcc
attgccgaagccaaccacggagcccttgaatattcggatgtgcaggcaattaacgaattt
gttcacccaatgacaggcacggtaggggaaattcttgacgctcagcagcacatggtagat
gtgggcgaacttgcaaaaaaagaattcggtgttgcaatggaggtcccacgtataattccc
ctgatagaggatgctcctgccctgcttcatgcaaaagaacttgcagaaaacacactcctt
tcctgggaaaaacggtttggagctgcaccggaaaaattcagggtattcctgggcaaatcc
gattctgccctctctttcgggcacgtggcaagtacgctctcatgcaaatacgccataagc
gggatttccgaaatggacttagaacttgacaccagcacaggcatcatattcggagcaggg
actctgccttttagagggcacctgagcctgaaaaatgctgaaaactttttcagggaatat
cggggcatagggacaatcaccctccagtcagctctcaggtacagccacgataaaggagaa
gctgaagccctggtacgccttgcagaagagaggcttccggaatctccagaaatctattcc
ggcgaagaaaaagaagagattgtaaaccttataggaattttcggggcaaggtataaccgc
attatccgtgaaatgtcctgcaccataaaccagcttgcaggcctcctacctcagcagcgg
gaccgccttatgcataaagggacaggaggttattcgaggaatgttcccgatatttcaggc
ctggtatgcctctgccggaaggatgtcggaaaagagctcagcgcgagtatgcctgcagaa
gacctgaaccttccacgggctattaagttcacaggtgcgctttattctataggcctgcct
ccggagtttataggcacgggcacagcccttgaagaagccagggaaaagctgggagaagaa
tcctgtgaaaggctgcttaagaaatatttcccttcccttgccagtgacctgagctttgca
tccggctacctggacctcaatgtagcttcccgcttccttccagaagcctgcctgaaagaa
atccgcaaagacgttgaggtcttgcgcgacactttcagccttaaagtccagccagaaccc
tcgtaccgcatcctgctcgaaatgatgcagccagaccttttgcaggcaggaacgaaagga
aactgcatggatgaagaagtctcgcagcttgtatgttcaactctcaccaaaatgggaaaa
atcagaaaggctctgggttaa

DBGET integrated database retrieval system