KEGG   Mycobacterium sp. MOTT36Y: W7S_21285Help
Entry
W7S_21285         CDS       T02113                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mmm  Mycobacterium sp. MOTT36Y
Pathway
mmm00250  Alanine, aspartate and glutamate metabolism
mmm00410  beta-Alanine metabolism
mmm00430  Taurine and hypotaurine metabolism
mmm00650  Butanoate metabolism
mmm01100  Metabolic pathways
mmm01110  Biosynthesis of secondary metabolites
mmm01120  Microbial metabolism in diverse environments
mmm02024  Quorum sensing
Module
mmm_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mmm00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    W7S_21285
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    W7S_21285
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    W7S_21285
   00430 Taurine and hypotaurine metabolism
    W7S_21285
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    W7S_21285
Enzymes [BR:mmm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     W7S_21285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AFJ37206
UniProt: I2AIT2
LinkDB All DBs
Position
complement(4656178..4657560)
Genome map
AA seq 460 aa AA seqDB search
MPQHPSLPAHSIAPAYTGRLFTAPVPALRMPDESMDPDAAYRFIHDELMLDGSSRLNLAT
FVTTWMDPEAGKLMAETFDKNMIDKDEYPATAAIEQRCVCMVADLFHADGLNDADPYSAC
GVSTIGSSEAVMLGGLAMKWRWRAKIGKDWKDRTPNLVMGSNVQVVWEKFCRYFDVEPRY
LPMEEGRYVITPEQVVDAVDENTIGVVAILGTTYTGELEPVADICGALDKLAAGGGVDVP
VHVDAASGGFVVPFLHPELKWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRSKEYLPDDL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYTKVMQALSGTARWLGEQLRV
SEHCELVSDGSAIPVVAFRLSKDRGYTEFDVSHELRTYGWQVPAYTMPDNATNVSVLRIV
VREGLSADLARALHDDAVSALSSLDKLRPGGHYADQHFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgccacaacacccttcgctgcccgcgcactccatcgcccccgcctacaccggccggctg
ttcaccgcgccggtccccgcactgcggatgcccgacgaatcgatggatcccgacgccgcc
taccgcttcatccacgacgagctgatgctcgacgggagttcgcggctgaacctggccacc
ttcgtcaccacctggatggaccccgaggccggcaagctgatggccgagacgttcgacaag
aacatgatcgacaaggacgagtacccggcgaccgcggccatcgagcagcgctgcgtgtgc
atggtggccgacctgttccacgccgacggcctgaacgatgccgacccctacagcgcgtgc
ggggtgtccacgatcggctccagcgaggcggtgatgctcggcgggctggcgatgaagtgg
cggtggcgcgcgaaaatcggcaaggactggaaggatcgcaccccgaacctggtgatgggg
tccaacgtccaggtggtctgggagaagttctgccgctacttcgacgtcgagccccgctac
ctgccgatggaggaggggcgctacgtcatcacccccgaacaggtcgtcgacgccgtcgac
gagaacaccatcggcgtggtggcgatcctgggcaccacctacaccggcgagctggagccg
gtcgccgacatctgcggcgcgctggacaagctggccgccggcggcggtgtggacgtcccg
gtgcacgtcgatgccgccagcggcgggttcgtggtgcccttcctgcaccccgagctcaag
tgggatttccggctgccccgggtggtgtcgatcaacgtcagcggccacaagtacgggctg
acctatcccggcgtcgggttcgtggtgtggcgcagcaaggagtacctgcccgacgacctg
gtgttccgggtcaactacctcggcggcgacatgccgaccttcacgctgaacttctcccgc
cccggtaaccaagtggtcggccagtactacaacttcctgcggctcggccgggagggctac
acgaaggtcatgcaggcgctgtcggggacggcgcgctggctgggcgagcagttgcgggtc
agcgagcactgcgagctggtctccgacggctcggcgatccccgtggtcgcgttccggctg
tccaaggaccgcggctacaccgagttcgacgtctcccacgagctgcggacctacggctgg
caggtgcccgcctacaccatgccggacaacgccaccaacgtctccgtgctgcgcatcgtg
gtgcgcgagggcctgtccgccgacctggcccgggccctgcacgatgacgccgtctcggcg
ctcagttcgctggacaagctccggcccggcggccactacgcggatcagcacttcgcgcac
tga

DBGET integrated database retrieval system