KEGG   Mus musculus (mouse): 14417Help
Entry
14417             CDS       T01002                                 

Gene name
Gad2, 6330404F12Rik, GAD(65), GAD65, Gad-2
Definition
(RefSeq) glutamic acid decarboxylase 2
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
mmu  Mus musculus (mouse)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
GABAergic synapse
Type I diabetes mellitus
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    14417 (Gad2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    14417 (Gad2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    14417 (Gad2)
   00430 Taurine and hypotaurine metabolism
    14417 (Gad2)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    14417 (Gad2)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    14417 (Gad2)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     14417 (Gad2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
2 A3; 2 15.15 cM
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSEDGSADPENPGTARAWCQVAQKFTGGIGNKLCALLYGDSGKPAEGGG
SVTSRAATGKVACTCDQKPCNCPKGDVNYAFLHATDLLPACDGERPTLAFLQDVMNILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILTHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMLIARYKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEVKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHIDKCLELAEY
LYTIIKNREGYEMVFDGKPQHTNVCFWFVPPSLRTLEDNEERMSRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcctggctccggcttttggtccttcggatctgaagatggctctgcggatcct
gagaacccgggcacagcgagagcgtggtgccaggtggcccaaaagttcacgggcggcatc
ggaaacaagctgtgcgctctgctctatggagactccgggaagccagcggagggcggcggg
agcgtgacctcgcgggccgccaccgggaaggtcgcctgcacctgcgaccaaaaaccctgc
aactgccccaaaggggatgtcaactacgcgtttctgcacgcaacagacctgctgccagcg
tgtgatggagaaaggcccactctggcatttctacaagatgttatgaacattttgcttcag
tacgtggtgaaaagtttcgatagatcaactaaagtgatcgatttccattaccccaatgag
cttcttcaagagtataattgggaattggcagaccaaccgcaaaatctggaggaaattttg
acgcattgccaaacaactctaaaatatgcaattaaaacagggcatccccgatattttaat
cagctgtctactggattggatatggttggattagcagcagactggttgacatcaacagca
aacactaacatgttcacctatgagatcgcccctgtatttgtgctgctagaatatgttaca
ctaaagaaaatgagagaaatcattggctggcccgggggctctggcgatggaatcttttct
cctggtggcgccatctccaacatgtatgccatgctcattgcccgctataagatgtttcca
gaagtcaaggagaaggggatggcagcagtgcccaggctcatcgcgttcacatcagagcat
agtcacttttctctcaagaagggagctgcagccttagggattggaacagacagtgtgatt
ctgattaaatgtgacgagagagggaaaatgattccatctgatcttgaaagaagaatcctt
gaagtcaaacagaaaggatttgttcctttcctggtgagtgccacagctggaaccaccgtg
tatggggcttttgatcctctcttggctgtagctgacatctgcaaaaagtataagatctgg
atgcacgtggatgctgcttggggtggagggttactgatgtcccggaaacacaagtggaag
ctgagtggagtagagagggccaactctgtgacatggaatcctcacaagatgatgggtgtc
cccttgcagtgttcagctctcctggttagagaggagggactgatgcagagctgcaaccag
atgcatgcttcctacctctttcagcaagataagcactatgacctgtcctatgacacagga
gacaaggccttgcagtgtggacgccatgtggatgtctttaaattatggctcatgtggaga
gcaaaggggactactgggtttgaggcacacattgataagtgtttggagctagcagagtat
ttatacactatcataaaaaaccgagaaggctatgaaatggtgtttgatgggaagcctcaa
cacacaaatgtctgcttctggtttgtacctcctagtttgcgcactctggaagacaatgaa
gagagaatgagccgcctctcaaaggtggcgccagtgattaaagccagaatgatggagtat
gggaccacaatggtcagctaccaacccttaggggacaaggtcaacttcttccgcatggtc
atctcaaaccctgcagcaactcaccaagacattgacttccttattgaagaaatcgaacgc
ctcggacaagatttgtaa

DBGET integrated database retrieval system