KEGG   Mus musculus (mouse): 14571Help
Entry
14571             CDS       T01002                                 

Gene name
Gpd2, AA408484, AI448216, AU021455, AW494132, GPDH, Gdm1, Gpd-m, Gpdh-m, TISP38
Definition
(RefSeq) glycerol phosphate dehydrogenase 2, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    14571 (Gpd2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     14571 (Gpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_1 EF-hand_7 FAD_binding_2 Pyr_redox_2 EF-hand_6 FAD_oxidored GIDA EF-hand_8 EF-hand_9 NAD_binding_8 HI0933_like Pyr_redox Pyr_redox_3 Thi4 EF-hand_10
Motif
Other DBs
NCBI-GeneID: 14571
NCBI-ProteinID: NP_001139292
MGI: 99778
Ensembl: ENSMUSG00000026827
Vega: OTTMUSG00000012561
UniProt: Q64521
LinkDB All DBs
Position
2 C1.1; 2 31.66 cM
AA seq 727 aa AA seqDB search
MAFQKAVKGTILVGGGALATVLGLSPFAHYRRKQVSLAYVEAAGYLTEPVNREPPSREAQ
LMTLKNTPEFDILVIGGGATGCGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMNLDVEQYRMVKEALHERANLLEIAPHLSAPLPIMLPLYKWWQLPYYWVGIKMY
DLVAGSQCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPETGKERVSGARCKDVLTGQEFDVRAKCVINASGPFTDSVRKM
DDKNVVPICQPSAGVHIVMPGYYSPENMGLLDPATSDGRVIFFLPWEKMTIAGTTDTPTD
VTHHPIPSEEDINFILNEVRNYLSSDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISDSGLITIAGGKWTTYRSMAEDTVDAAVKFHNLNAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAKTYGDKAFEVAKMASVTGKRWPVVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWSELRKQEELETATRFLY
YEMGYKSRTEQLTDSTEISLLPSDIDRYKKRFHKFDEDEKGFITIVDVQRVLESINVQMD
ENTLHEILCEVDLNKNGQVELHEFLQLMSAVQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcaaaaggcagtgaaggggactattcttgtgggtggaggagctctggccact
gttttgggactctctccgtttgctcattacagaaggaagcaagtgagcctggcatatgtg
gaagcagcaggatacctcacggagcctgtgaacagggaacctccctccagagaagctcag
ctcatgactttgaagaacacacccgaatttgacatccttgttatcggaggcggagccaca
gggtgtggctgtgcactagatgccgtcaccagaggactgaaaacagcccttgtagagaga
gatgacttctcatcggggactagcagtagaagcactaaattgatccacggtggtgtgcga
tacctccagaaggctatcatgaacttggatgttgagcagtataggatggtgaaagaagcc
cttcacgaacgtgccaacttactagaaatcgctcctcatttatcagctccgttgcctatc
atgcttccactttacaagtggtggcagttaccttattactgggtgggaatcaagatgtat
gacctggttgcagggagtcaatgcctgaagagcagttacgtcctcagcaaatcccgagcc
ctggagcattttcccatgctccagaaggacaagctggtaggcgccattgtctactatgac
ggacaacacaacgatgcacggatgaacctcgccatcgccctcactgctgccaggtacggg
gctgccacggccaattacatggaggtggtgagcttgctcaagaagacagaccctgaaacc
ggcaaagagcgagtgagcggtgcgcggtgcaaggatgtgctcacagggcaggaatttgac
gtgagagccaaatgcgttatcaatgcctccggccctttcacagactccgtgcgcaaaatg
gatgataaaaacgttgttcccatctgccagcccagtgccggggtccatattgtgatgccc
ggatactacagccctgagaacatgggacttcttgatcctgcaaccagtgatggcagagtg
attttcttcttgccttgggagaagatgacaattgctggcaccactgatacgccaacggac
gtcacgcaccatcctattccttcagaagaagacattaacttcatcctgaatgaagtgcgg
aactacctgagttctgacgttgaagtgagaagaggggatgtcttggcagcctggagtggt
atccgtccccttgttaccgatcccaagtctgcagacactcagtccatctctcgaaatcat
gttgtggacatcagtgacagcggactcatcacaatagcaggtgggaagtggaccacctac
cgctccatggcagaagataccgtggatgcagctgtcaagtttcacaacttgaatgcggga
ccgagtaggactgttgggctgttccttcaaggaggcaaagactggagccccacactctac
atcaggcttgtccaggattatgggcttgagagcgaggttgcacaacatctggccaaaacc
tatggtgacaaggctttcgaggtggccaaaatggcaagtgtgactggaaagcggtggcct
gttgttggagtgcgtcttgtgtcagaatttccatacattgaagcagaggtgaaatacggg
attaaggagtatgcctgcactgcagttgacatgatctcacggcgcacccgcctggccttt
ctcaatgttcaggctgcagaggaagccctgcctaggattgttgaactaatgggaagagag
ttgaactggagtgaattgaggaaacaggaagaacttgaaacagccacgagatttctgtac
tatgaaatgggctacaagtctcgaacagaacaacttacagatagcactgaaatcagcctg
ctgccttcagacatcgataggtacaagaagagatttcacaagtttgatgaagatgaaaaa
ggcttcattaccattgttgatgttcagcgtgtcctagagagtatcaatgtacaaatggac
gaaaacacactgcatgaaattctctgcgaagtagatttgaacaaaaatggacaggttgag
ctgcacgagtttctgcagctgatgagcgcagttcagaaaggaagggtctctggaagccga
cttgccatcctgatgaaaactgccgaggagaacttggaccgcagagttccaatccccgtg
gaccgtagttgtggaggattgtga

DBGET integrated database retrieval system