KEGG   Mus musculus (mouse): 16882Help
Entry
16882             CDS       T01002                                 

Gene name
Lig3, D11Wsu78e
Definition
(RefSeq) ligase III, DNA, ATP-dependent
  KO
K10776  
DNA ligase 3 [EC:6.5.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Base excision repair
Module
BER complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    16882 (Lig3)
Enzymes [BR:mmu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     16882 (Lig3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     16882 (Lig3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
11 C; 11 50.23 cM
AA seq 1012 aa AA seqDB search
MTLAFKILFPRNLCALGRKELCLFPEQNRWAAISQFSQWSETNLLGGCCLLQRRKPVLAL
QRGHLRPRATHLTFWPGSHVGLCTGPCAMAEQRFCVDYAKRGTAGCKKCKEKIVKGVCRI
GKVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDNEKEQISQ
HIADLSSKAAATPKKKAAVQAKLTTTGQVTSPVKGASFITSTNPRKFSGFSAAKPNNSEQ
APSSPAPGTSLSASKCDPKHKDCLLREFRKLCAMVAENPSYNTKTQIIHDFLQKGSTGDG
FHGDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRIFF
EQSKSFPPAAKSLLTIQEVDAFLLHLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKH
DLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNEQEVEKDPGRRRALRVQASLM
TPVQPMLAEACKSIEYAMKKCPNGMFSEIKYDGERVQVHKKGDHFSYFSRSLKPVLPHKV
AHFKDYIPKAFPGGQSMILDSEVLLIDNNTGKPLPFGTLGVHKKAAFQDANVCLFVFDCI
YFNDVSLMDRPLCERRKFLHDNMVEIRNRIMFSEMKQVTKASDLADMINRVIREGLEGLV
LKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDP
DSQKWCTVTKCAGGHDDATLARLQKELVMVKISKDPSKIPSWLKINKIYYPDFIVPDPKK
AAVWEITGAEFSRSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKDKADF
AVVAGDEASPTTGGSSGENEGTAGSAGPCKGPPSKSSASAKTTEQKLNSPSSRGGIKPIP
KHSPMKPGEKLAVKSSPVKVGMKRKATDETPCLKKVLLDVFTGVRLYLPPSTPDFKRLKR
YFVAFDGDLVQEFDMGSATHVLGNREKNTDAQLVSSEWIWACIRKRRLIAPC
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgactttggctttcaagatcctcttcccgagaaacctttgtgcccttggcagaaaagaa
ctgtgcctgttcccagaacagaatcgctgggctgccataagtcagttcagccagtggtcg
gaaacaaatctcctcggtgggtgctgccttctccagagaagaaagcctgtcctagctctc
cagagaggtcatctaagaccacgtgccacccaccttactttctggccagggtcgcatgtg
ggactctgtactggcccctgtgcgatggcagagcagcggttctgtgtggactatgccaag
cggggcacagctggatgcaagaaatgcaaggagaagattgtaaagggcgtgtgccgcatt
ggcaaagtggtgcccaaccccttctcagagtctgggggtgatatgaaagagtggtaccac
attaagtgcatgtttgagaaactggaacgggctcgggccaccacaaagaaaattgaagac
ctcacagagctggaaggctgggaagagctggaagataacgaaaaggaacagataagccag
catattgcagacctgtcttctaaggcagctgccacacctaagaagaaagctgctgtccag
gctaagctgacaaccactggccaggtgacatctccagtgaaaggtgcttcgtttattacc
agtaccaatcctcggaagttctctggcttttcagcagcaaaacccaacaactctgagcaa
gccccctcaagccctgctcctggaacgagtctgtctgcaagtaaatgtgaccctaagcac
aaagattgtctgctacgagagttccggaagctgtgcgccatggtggctgaaaatcctagc
tataacaccaagacccagatcatccatgacttcttgcagaaaggctccacaggagatggc
tttcacggtgatgtgtacctgacagttaagctgctgctgcctggtgtcatcaagagtgtt
tacaacttgaatgataagcagattgtaaaactttttagccgaatttttaactgcaaccca
gatgatatggcccgggacctagaacagggtgacgtgtcagagacgatcagaatcttcttt
gagcagagcaagtctttccccccagctgccaaaagcctcctcaccattcaggaagtggat
gccttcctcctgcacctctccaagctcaccaaagaggatgagcagcagcaggccctgcag
gacatagcctcccggtgtacagccaatgaccttaagtgcattattcggctgatcaaacat
gatctgaagatgaactcgggtgcaaaacacgtgttagatgcccttgaccccaatgcttat
gaagccttcaaagcatcgcgcaacctgcaggatgtggtggagcgagtccttcacaatgag
caggaggtggagaaggacccaggccggcgacgggctctgagggtccaggcctcactgatg
acgcctgtgcagcccatgctggctgaggcctgcaaatccattgaatatgcaatgaagaag
tgtcccaatggcatgttctctgagatcaagtacgatggtgagcgagtccaggtgcataag
aagggggaccacttcagctacttcagccgcagtctcaagcctgtcctgcctcacaaggtg
gcccacttcaaggactatatacccaaagcttttcctgggggtcaaagcatgatcttggat
tccgaggtactcctgattgacaacaacacaggcaaaccactgccctttgggactctggga
gtgcacaagaaagctgctttccaggatgctaatgtctgcctgtttgtttttgattgtatc
tactttaatgatgtcagcttgatggacaggcctctctgtgagcgacggaagtttcttcat
gacaacatggttgaaatccgtaaccggatcatgttctcagaaatgaagcaagtcacaaaa
gcttcagacctggctgacatgataaaccgggtgatccgagagggcttggaagggttggtg
ctaaaggatgtgaagggtacatatgagcctgggaagcggcactggctgaaagttaagaaa
gattatttgaatgagggggccatggctgatacagctgatctggtggttcttggggccttc
tatgggcaagggagcaaaggcggaatgatgtccatcttcctcatgggctgctatgaccct
gacagccaaaagtggtgcactgttacaaaatgtgctggaggccatgatgatgccacactt
gcccgcctgcagaaagagctggttatggtgaagatcagcaaggatcctagtaagataccc
agctggctgaagatcaacaagatctattatcctgactttatcgtcccagacccaaagaaa
gctgctgtgtgggagatcacaggggcagaattctccagatctgaggcacacactgctgat
ggcatctccatccgatttcctcgatgcacccgaatccgggacgacaaggactggaaatct
gccactaacctcccccaactcaaggaactgtaccagctgtccaaagacaaggcagacttt
gctgtggtggctggagatgaggcaagccccactactggaggcagcagtggcgagaacgag
ggcactgctgggtctgctgggccctgcaagggcccccccagtaagtcctctgccagtgcc
aagaccaccgaacagaagctcaatagccccagtagcagaggtggcatcaaaccgattcca
aagcattcccccatgaaaccaggagagaagctggctgtgaagtcttctccagtcaaagtg
ggaatgaagaggaaagctactgatgagaccccatgcctgaaaaaggtactgttggatgtc
ttcactggggtgcggctctacttgccaccttctacaccagacttcaaacgtctcaaacgc
tactttgtggcattcgacggggacctggtacaggaatttgacatgggctcagccacacat
gtgctaggtaacagggaaaagaacactgatgcccagttggtctcctcagagtggatttgg
gcatgtatccggaaacggaggctgatagctccctgctag

DBGET integrated database retrieval system