KEGG   Mus musculus (mouse): 192195Help
Entry
192195            CDS       T01002                                 

Gene name
Ash1l, 8030453L17Rik, Ash1, E430018P19Rik, Kmt2h
Definition
(RefSeq) ASH1 like histone lysine methyltransferase
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
mmu  Mus musculus (mouse)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    192195 (Ash1l)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     192195 (Ash1l)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     192195 (Ash1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
3; 3 F1
AA seq 2958 aa AA seqDB search
MDPRNTAMLGLGSDSEGFSRKSPSTINPGTLASKREAEIEGATEEEDPRKRNRERGTEAG
KEDGSTDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTIKHSRK
ALKSGKMTDEKNEHCPSKWDSSKLFKKAGDATAIDCQAEESIHLHSQGESNPLSKKLSPV
HSQMADYISAAPSLVGSRDPDIKDRALLNGGTSVTEKLAQLIATCPPSKSSKAKPKKLGT
GTTVGLVSKDLIRKPGVGSIAGIIHKDLIKKPALSTAVGLVTKDPGKKPMFNAAVGLINK
DSVKKLGTGTTAVFINKDLGKKPGAITTVGLLSKESGKKLGIGIVPGLVNKESGKKLGLG
TVVGLVNKELGKKLSSTVGLVAKDVTKKIVASSAMGLVNKDIGKKLLNCPMAGQLGSKDA
LNLKSEALLPTQEQLKASCSANISNHDSQELPESLKDSATGKAFEKSVMRHSKESMLEKF
SVRKEITNLEKEMFNEGTCIQQDNFSSSERGAFETSKHEKQPPVYCTSPDFQIGGASDAS
TAKSPFSAVGESNLPSSSPTVSVNPVTRSPPEASSQLVPNPLLLNSTAEQMEEISESIGK
SQFTAESTHLNVGHRSLGHSLSIECKGIDKELNESKNTHLDIPRISSSLGKKPSLTSDSG
IHAITPSVVNFTSLFSNKPFLKLGAVTAPDKHCQVAESLSSSFQSKPLKKRKGRKPRWTK
VVARSTCRSPKGLDLERSELFKNVSCSSLSNSSEPAKFMKTIGASSFVDHDFLKRRLPKL
SKSSAPSLALLTDSEKPSHKSFITHKLSSSMCVTSDLLSDIYKPKRGRPKSKEMPQLEGP
PKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQSLSVSPFPKKRGRPKRQMRSPVK
MKPPVLSVAPFVATESPSKLESESENHRSSSDFFESEDQLQDTDDLDDSHRQSVCSMSDL
EMEPDKKISKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSNKGKVQSKLHNTV
SSLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKTVLNGLLSGSPASLAVLEQTAQQAAG
SALGQILPPLLPSPASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPYLHVHSRQ
GSMIQTLAMKKASKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPVSESHSDETIPSDSG
IGTDNNSTSDRAEKFCGQKKRRHSFEHISLIPPETSTVLNSLKEKHKHKCKRRSHDYLSY
DKMKRQKRKRKKKYPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRI
NFNSFYTHPSFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSSTGFYPSY
GMPYSPSPLTAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHAGHLLLNPTKYHKK
KHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSEQPQVSMD
SGSSRSVLESLKRYRFGKDTVGDRYKHKEKHRCHMSCPHLSPSKNLINREEQWVSREPSE
SSSLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHMNLFTSAIGSCRVSNPNSSC
RKKLTDSPGLFPVQDTALNRPHRKEPLPSSERAIQSLAGSQSASDKPSQRSSESTNCSPT
RKRSSSESTSSTVNGVPSRSPRLVASMDDSVDSLLQRIVHHDEQESMEKNGDASITTVSA
PPSSSPGHSYSKERALGKSDSLLVPAVPNDSCSNIPLLSEKSASRCSPHHIKRSVVEAMQ
RQARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKCPLQAVVSM
QAFQAAQFVSPELNEGEDMSLHLSPDTVTDVIEAVVQSVNLTSEHKKGVKRKNWLLEEQT
RKKQKTVPEEEEQENNKSFIETPVEIPSPLETPAEPSEPENTLQPVLALIPREKKAPRPP
KKKYQRAGLYSDVYKTIDPKSRLIQLKKEKLEYTPGEHEYGLFPAPIHVGKYLRQKRIDF
QLPYDILWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCG
DDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQF
IIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCE
MQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIGGKSQR
MNGLPSHKGSQSSSTHRKSARAKEKRKSKHKLKKRKGHPSEEPSENINTPTRLTPQLQMK
PMSNRERNFVLKHHVFLVRNWEKIHQKQEEVKHTRDIHSASLYTRWNGLCRDDGNIKSDV
FMTQFSALQTARSVRTRRLAAAEENLEVARAARLAQIFKEICDGIISYRDSSQQTLAAPL
LNLPPKKKNADYYEKISDPLDLSTIEKQILIGYYKTVEAFDADMLKVFRNAEKYYGRKSP
IGRDVCRLRKAYYSARHEASAQIDEIVGETASEADSSETSVSEKESGHEKDDDVIRCICG
LYKDEGLMIQCDKCMVWQHCDCMGVNTDVEHYLCEQCDPRPVDREVPMIPRPHYAQPGCV
YFICLLRDDLLLRQGDCVYLMRDSRRTPDGHPVRQSYRLLSHINRDKLDIFRIEKLWKNE
KEERFAFGHHYFRPHETHHSPSRRFYHNELFRVPLYEIIPLEAVVGTCCVLDLYTYCKGR
PKGIKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFDHFPKKLTPKRDFSPHYVPD
NYKRNGGRSSWKSERSKPPLKDLGQEDDALPLIEEVLASQEQAAREVPSPEEPDQERATG
DIGDAEKKPEESSQEAQLASTPEERRHSQRERLNQILLNLLEKIPGKNAIDVTYLLEEGS
GRKLRRRTLFIPENSFRK
NT seq 8877 nt NT seq  +upstreamnt  +downstreamnt
atggaccctaggaatactgctatgttaggattgggttctgattccgaaggattttcaaga
aagagtccttctaccatcaatcctggcactctggccagcaaaagagaagcagagatagag
ggtgccacagaagaagaggatcctcgcaagcggaatcgagaaaggggcacagaagcagga
aaggaggatggctcgacggatgcacagcaacagttttcagtgaaagaaacaaacttttca
gagggaaacttaaaattgaaaattggccttcaggcaaagagaactaaaaagcctccaaag
aacttggagaactatgtgtgtcgacctgccataaagacaaccatcaagcactcaaggaaa
gcacttaaaagtgggaagatgacagatgagaagaatgagcactgcccttcaaaatgggac
tcttcaaaattgttcaagaaagcaggtgacgctacagccatcgactgccaagccgaagaa
agcatccatcttcattcacagggggaaagtaatcctttgtctaagaagctttctccagta
cattcacaaatggcagattacattagtgcagcaccatctcttgttggcagtcgagatcct
gatataaaggacagagcattacttaatggaggaactagtgtaacagaaaagttggcacag
ctcattgctacctgtcctccttccaagtcttccaaggcaaaaccgaagaagttaggaact
ggcactacagttggattggttagcaaggacttgatcaggaaaccaggtgttggctctata
gctggaataattcataaagacttaattaaaaagccagctcttagcacagcagttgggttg
gtaactaaagatccagggaaaaagcctatgttcaatgcagcagtaggcctgatcaataag
gactctgtgaaaaaattgggaactggcactacagccgtattcattaataaagacttaggc
aaaaagccaggggctatcactacagttggactgctgagcaaagaatcaggaaagaagcta
ggcattggtattgttccagggctagtgaataaagagtctggcaagaaattaggacttggc
accgtagttggactggttaataaagagttgggaaagaaactgagttctacagttggccta
gtggccaaggatgttacgaagaagattgtagcaagctcagcaatgggattggttaataag
gacattggaaagaaattattaaattgtcctatggcaggacaactgggcagtaaagatgcc
ttaaaccttaaatctgaagcactgctccccactcaggaacaacttaaggcttcctgtagt
gcaaacataagtaatcatgacagtcaagaacttcctgagtctctgaaagacagtgctacc
ggcaaagcttttgagaagagtgttatgcggcatagtaaagaaagcatgttggaaaaattt
tcagtccgaaaagaaattactaatttggagaaagaaatgtttaatgaaggaacatgcatt
cagcaagacaatttctcatctagtgaaaggggagcctttgaaacctcaaaacatgaaaag
cagcctcctgtgtattgcacttctcctgactttcaaataggaggtgcctctgatgcctct
acagctaaatctcccttcagtgcagtaggcgaaagcaaccttccttcctcgtcacctact
gtatctgttaatcctgtaaccaggagtccccctgaagcttcttcacagttggttccaaac
ccattacttttaaattctacagcagaacaaatggaagaaatctctgaatctattggaaag
agccagtttactgctgaaagtacccacttgaatgttggtcacagatcattaggtcatagc
ttaagtattgagtgtaaaggaattgataaagaactaaatgaatcaaaaaatacacatcta
gatattcctagaataagttcttccttgggaaaaaagccaagtttgacttctgactctggt
attcatgcaattactccttccgttgttaattttactagtttgtttagtaacaaacctttt
ttaaagcttggtgcagtcactgcaccagacaaacactgccaggttgctgaaagcctaagc
tcgagtttccagtccaaaccattgaaaaaaagaaaaggaagaaaacctcggtggactaaa
gtggtggcaagaagcacatgccggtctccaaaaggactagacttagaaagatcagagctt
tttaagaatgtttcttgtagctcactatcaaatagttctgagccagcgaagtttatgaaa
actatcggagcatcatcattcgtcgatcatgacttccttaaacgccgattgccaaagttg
agtaagtcttcagctccatctcttgctcttttaaccgacagcgagaaaccatctcataag
tcttttattactcacaaactgtcctccagtatgtgtgtcactagcgatcttttgtcggat
atttataagcccaagagaggaagacctaaatccaaggaaatgcctcagctagaaggtcca
cctaaaaggactttaaaaatacctgcctctaaagttttttctttacagtctaaagaagag
caagaacccccaattttacaaccagaaattgaaattccttccttcaagcaaagtttgtct
gtatctccttttccaaaaaaaagaggcaggcctaagaggcagatgaggtctccagtgaag
atgaaaccccctgtcctgtcagtggctccatttgttgccactgaaagtccaagtaagctc
gagtctgaaagtgagaaccatagaagtagcagtgacttttttgagagtgaggaccagctt
caggacacagacgacttagatgacagtcacaggcaaagtgtctgtagtatgagtgacctt
gagatggaaccagataaaaaaattagcaagcgaaacaatggacaattaatgaaaacaatt
atccgaaaaataaataaaatgaagactttaaagagaaaaaaactgttgaatcagattctt
tcgagttctgtagaatcaagtaataaaggaaaagtgcagtccaagcttcacaatacagtc
tcaagtcttgctgccacatttggctctaaattggggcaacaaatcaatgtcagcaagaaa
ggaaccatttacatagggaagagaagggggcggaaaccaaaaaccgtcttaaatggcctg
ctttctggtagccctgccagccttgctgtgcttgaacaaacagctcagcaggcagctggg
tcagcattaggacagatcctcccccctttactgccatcacctgctagtagctctgagatc
cttccatcacctatttgctctcagtcttctgggactagtggaggtcagagccctgttagt
agtgacgcaggctttgttgaacctagctcagtgccatatttgcatgtgcactccagacag
ggcagtatgattcagactcttgcaatgaagaaggcttccaagggcagaaggcggctctct
cctcctactttgttgccaaattctccttctcatttgagtgaactcacatccctgaaagaa
gccactccttccccagttagtgagtctcatagtgacgagaccattcccagtgacagtggc
attgggacagataataatagcacatcagacagggcagagaagttttgtggacagaaaaag
aggagacattcttttgagcacatttctctgattccccctgaaacttctaccgtcctaaac
agtctcaaagaaaaacacaaacacaaatgtaagcgcaggagtcacgattacctcagctat
gacaagatgaaaagacagaagcgaaaacggaaaaagaaatatccccagcttcgaaatagg
caggatccagacttcatcgcagaactagaggagctgataagtcgtctaagtgagattcgg
atcacccatcgaagccatcattttattccccgagacctcctgccaactatttttcgaatc
aactttaatagtttctatacacatccttcttttcccttagacccattgcactacattcgg
aaacctgacttaaaaaagaaacgagggaggccccctaagatgagggaggcaatggcagaa
atgccttttatgcacagccttagttttcctttatctagtactggattttatccttcttat
ggcatgccttactctccctcaccccttacagctgctccaataggattagggtattatgga
aggtatccccccactctttatccaccgccaccatctccttcattcaccactccactgcca
cctccctcctatatgcatgctggtcatttattgctcaatcctaccaaatatcataagaaa
aagcataagctgcttagacaggaggcttttcttacaaccagcaggacccctctcctttcc
atgagcacctaccccagcgtacctccagagatggcttatggttggatggtggagcacaaa
cacagacaccgtcacaaacacagagagcaccgttctgaacagccccaggtttccatggat
agtggctcttccagatccgtcttggagtctttgaaacgttaccgatttggtaaggatact
gttggagatcgatataagcataaggaaaagcacaggtgtcacatgtcctgccctcatctc
tctccttcaaagaacttaataaacagagaagaacagtgggtttctcgagagccttcagaa
tcaagttctttagccttgggattgcaaacacctttacaaattgactgctcagaaagttct
cccagtttgtcccttggaggatttactcccaattctgagccagccagcagtgatgaacat
atgaacctttttacaagtgcaataggcagctgcagagtttcaaaccctaactccagttgc
cggaagaaattaactgacagccctgggctctttcctgtacaagatactgcactaaatcgg
cctcacagaaaggaaccattaccttccagtgaaagggcaatacagtcgttggcaggttcc
cagtcagcttccgataaaccttcccagcgatcatcagaaagcacaaattgtagccctact
cgtaaaaggtcttcatctgagagtacttcttcaacagtgaatggagttccttccagaagt
cccagattggttgcttctatggatgattctgtagacagtctgttgcagcggatagtacat
cacgatgagcaagagtccatggagaaaaacggtgatgcttccattacaactgtgtctgca
ccaccttcttccagtccaggccatagctacagcaaggagcgagccttaggtaaatcagac
agccttctagtgcctgcagtcccgaatgactcttgcagtaatatcccacttctttctgaa
aagtcagcaagtaggtgttccccccatcacatcaagagaagtgtagttgaagctatgcaa
cgccaagctcggaaaatgtgcaattatgacaaaatcttggccaccaagaaaaacctggac
catgttaataaaattttaaaagccaaaaaacttcaaaggcaggccaggacaggaaacaat
tttgtgaaacgcagaccaggtcgacctcggaaatgccccctccaagcagtggtgtcaatg
caagccttccaggccgcccagtttgtcagcccggaattgaatgaaggcgaagacatgtcc
ctgcacctaagtccagacacagtcactgatgtgatcgaggctgtggttcagagtgtgaac
ctcacttcagaacataagaagggggtgaagaggaaaaattggctgttagaagaacagact
aggaaaaagcagaagacagtaccagaggaagaagagcaagaaaacaataaaagctttata
gaaacaccagttgaaattcccagtcctcttgaaacgcctgctgaaccttctgaacctgaa
aataccttgcaacctgtgctggctctcatcccacgagaaaagaaggccccacgtcctcca
aagaagaaataccagagagctgggctgtattctgatgtttacaaaacaatagacccaaag
agccgattaatccaattaaagaaagaaaagttggagtatactccaggagagcacgagtat
gggttgttcccagcgcccattcatgttggaaagtatctcagacagaagagaattgacttc
cagcttccctatgatattctctggcagtggaaacacaatcagctatacaaaaagccagat
gtccccctgtataaaaaaatccgttcaaatgtctatgttgatgtcaaaccactttctggt
tatgaggctaccacctgtaattgtaagaagccagatgacgacaccaggaagggctgtggg
gatgactgcctaaatagaatgatctttgctgagtgttcccctaacacttgcccctgtggt
gagcagtgctgtaaccagaggatacagaggcatgagtgggtgcagtgtctggaacgattt
cgagctgaggaaaaaggttggggaattagaaccaaagaacccctaaaagctggccagttc
atcattgaatacctaggggaagttgtcagcgaacaagaattcaggaacaggatgattgag
caatatcataatcacagtgaccactactgtttaaacctggatagcggaatggtgattgac
agttaccgcatgggaaatgaggccagattcatcaaccacagctgtgacccaaattgtgaa
atgcagaaatggtctgttaatggagtgtaccgtattggactgtatgcacttaaggatatg
ccagctgggacagagcttacctatgattacaactttcattccttcaatgtagaaaaacag
caactttgtaaatgtggttttgagaagtgtcgaggaatcattggaggcaagagtcaacgg
atgaacggactccctagccataaaggtagccagtcttcaagcacgcatagaaagtctgca
cgggcgaaagagaagcggaagtccaagcacaagctgaagaaaaggaaaggccatccctct
gaagagcccagtgaaaacatcaacaccccaacaagattgactccacagttacagatgaag
ccaatgtccaacagagagaggaacttcgtgctaaagcaccatgtgttcttggtgcgaaac
tgggaaaagatccatcagaagcaggaggaggtgaagcacacccgtgacatccactcagca
tcgctgtacacccgctggaacggcctctgtcgggacgacgggaacattaagtctgatgtc
ttcatgacccagttctctgccctgcagacagctagatctgttcgaacaagacgcttggca
gctgcagaggaaaacctggaagtggctcgggcagcgcgcctagcacagatcttcaaagag
atctgtgatggcatcatctcctacagagattcttcccagcaaacccttgcagctccactt
ttgaatcttcccccaaagaaaaaaaatgctgactattatgagaagatctctgaccccctg
gatctcagcaccatagagaagcagatcctcattgggtattacaaaacagtggaggctttc
gatgctgacatgcttaaggtctttcggaatgctgagaagtactatgggcgtaaatcccca
attgggagagatgtttgccgcttacgaaaggcctattacagcgcccggcatgaagcttcg
gctcagatcgatgagattgtgggagaaacggccagtgaggccgacagcagcgagacctca
gtctccgagaaggagagcgggcacgagaaggatgatgatgttatccgctgcatctgcggc
ctctataaagatgaaggcctcatgatccagtgtgacaagtgcatggtgtggcagcactgc
gactgcatgggtgtgaacacggatgtggagcactacctttgtgagcagtgtgaccctcgg
cctgtggacagggaggtacccatgatccctaggccccactatgcccagcccggctgtgtc
tacttcatctgtttactccgagatgacttgctgcttcgtcagggtgattgtgtgtacctg
atgagggacagtcggcgcacgcctgatggccacccagtccgtcagtcctacagactctta
tctcacattaaccgagataaacttgacatctttagaatcgagaagctctggaagaatgaa
aaagaagaacggtttgcctttggtcaccattatttccgcccacatgagactcatcactct
ccatcccgtcggttctatcacaacgagctgttccgggtgcccctctatgagatcattccc
ttggaggccgtagttgggacctgctgtgtgttggacctttatacatactgtaaagggaga
cccaaaggaataaaggaacaagatgtgtatatctgtgattatcggcttgacaagtcagca
caccttttttacaagattcatcggaatcgatatccggtctgcaccaaaccctatgccttt
gatcatttccccaagaagctcactcccaaaagagacttctcacctcattatgtcccagac
aactacaagaggaacggaggacgatcatcctggaagtctgaacgctcaaagccaccccta
aaagacctaggacaagaagatgatgctttgcccttgattgaagaggtactggctagtcag
gagcaagcagccagggaagtgcccagccctgaggagccagaccaggaaagagccactggg
gacattggggacgctgaaaagaaaccagaggagagcagtcaagaagcccagttagccagc
acacctgaggagcgaaggcacagccagagggaacggctcaaccagatcctgctcaacctc
cttgagaaaatacctgggaaaaatgccattgacgtgacctacctgctggaggaagggtcc
ggcaggaaactgcgaaggcgcactttgtttataccagaaaatagctttcggaagtga

DBGET integrated database retrieval system