KEGG   Mus musculus (mouse): 217246Help
Entry
217246            CDS       T01002                                 

Gene name
Ace3, EG217246
Definition
(RefSeq) angiotensin I converting enzyme (peptidyl-dipeptidase A) 3
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    217246 (Ace3)
   04614 Renin-angiotensin system
    217246 (Ace3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    217246 (Ace3)
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    217246 (Ace3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     217246 (Ace3)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M2
   217246 (Ace3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   217246 (Ace3)
CD molecules [BR:mmu04090]
 Proteins
  217246 (Ace3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
11; 11 E1
AA seq 737 aa AA seqDB search
MNLPWALLLVLLSHRQLLPWLRTVGETSLNDFYSEAQAKLFLQFYEQTAQVVLNEFMEAT
WNYVTNITKQNQKNMLQKEADRSQFMLYFSTRARMFRTDHFLNQDVKRMLRKLQNIDKSA
LPTEDLLEYNRLLTYMETAYNRAEVCLDEGPCLTLEPDLQEIMATSRDQKELLWAWQGWR
DAVGRQLRPVFEDYVRLSNKAAQYNGYKDMGALWRSKYESDTLEEDLEQLYKELQPLYLN
LHAYVRRSLYRYYGPELIDLRGPIPAHLLGNMWAQSWNNILDLVLPYPTKAPEDITAIMK
IQHWRPEKMFEEANLFFTSMGMLPAPPAFWIKSMMEKPADGREVECHTSSWNFYKFNDFR
VKKCTEVTLEDLLSVFHQMGHIQYFLQYQNLSVIYQEGASPAFEEAVGSVIALSVSSHKY
LLARGLLSQPHQDSEEEVNFLLGIALEKIAFIPFSYLVDKFRWKIFDGTISKITYNQEWW
NFRLKYQGLCPPVPRSDDDFDPGAKFHIPANVPYIRYFLGLILQFQLHEALCEASGHVGP
LHQCDNYNSKVAGKILGDLLKLGSSRPWREVLQEVTGESNISTKAFLTYFKPLMDWLVTE
NVKQGDTLGWPDFSCSFEEKITSKVSFLGTDTEPEQAYLGQWVLLSMSFFMLVLILALGF
RLHYLEKQLLDEDTMILKTLPYSYFLGIAMEPHQAARKQWLLLGLCCILMLCCIGLLIRI
VTQNTENTPWMKNEGQS
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgccctgggccttgctacttgtgctcctctctcaccggcaactcttgccatgg
ctcaggactgtgggagagacaagcttaaatgatttctacagcgaggctcaggctaagttg
ttcctgcagttttatgagcaaacagcccaggtcgtgttgaatgagtttatggaagccact
tggaactacgtcaccaacatcaccaagcagaatcaaaagaacatgctgcagaaggaggcg
gacaggtctcagtttatgttatacttcagcacccgggcccgcatgtttaggacagaccat
ttcctgaaccaggacgtgaagcgcatgctgaggaagctgcagaacatagacaagtcggcc
ttgcccacggaggatctcctagagtacaacagacttctgacctacatggagacagcatat
aaccgagctgaggtgtgcctggatgagggtccctgcttgaccctagagcctgacctccaa
gaaatcatggccacctccagggaccagaaggagctgctgtgggcctggcagggctggcgg
gatgctgttggccgacaactccgccctgtctttgaggactacgtacgtctcagcaacaag
gctgcccaatataatggatacaaagacatgggggctttatggcgatccaagtatgaatct
gacacgctggaggaagacctagagcagctctataaggagctgcagcctctctacctgaac
ctccatgcctatgtgcgccgctcactgtaccgctactacgggcctgagctcattgacctg
agggggcccatccctgcccacctcctggggaacatgtgggctcagtcctggaataatatc
ctagatctggtcctgccctatccgactaaagccccagaggacatcacagcgatcatgaag
atccagcactggaggcctgagaaaatgtttgaagaggctaacttattctttacctcaatg
ggcatgctacccgccccgcctgctttctggataaagtctatgatggagaagccagctgac
gggcgggaagtggagtgccacacctcatcctggaacttctacaagttcaatgacttcagg
gtaaagaagtgcacggaagtgaccttagaagacctgctctccgtcttccaccagatgggc
catatccagtacttcttgcagtatcagaatctctctgtcatctaccaggaaggtgccagc
ccagcctttgaagaggctgtggggtcggtgatcgccctctcagtctcttcccacaagtac
ctgctcgccagaggtctgctcagccaacctcaccaggattcagaggaggaggtcaacttc
ctgttaggcattgccctggagaagattgccttcatccccttcagctacctggtagacaag
tttcgttggaagatctttgatggcactatttcgaagattacatacaaccaggagtggtgg
aacttcaggttgaagtaccaaggcctgtgcccacctgtccctcgatcagacgatgatttt
gacccaggtgccaagtttcacatccctgccaatgtgccctatatccgatactttcttggt
ctgatactgcagtttcaacttcatgaagcactatgcgaagcctccggccacgtgggccct
ctgcaccagtgcgataactacaactccaaggttgcagggaagatcttgggggatctcctg
aagttgggctccagccggccctggcgggaggtcctccaggaggtgactggagagtccaat
atatccaccaaggcctttttgacctacttcaagccactgatggactggctggtgactgaa
aacgtgaagcaaggggacacccttggctggccagacttcagctgttcttttgaagaaaaa
atcacaagcaaagtatcgtttctgggcacagacacagagcctgagcaggcgtacctgggg
cagtgggtgttgctgagcatgagttttttcatgttggtcctcatcctggcactgggcttc
aggctgcactacttggaaaaacagttactggacgaagacacaatgattcttaagaccctg
ccctactcctacttcctgggcatagccatggaaccccatcaggcagcccggaaacagtgg
cttctgctgggcctctgctgcatccttatgctgtgctgtattggcctgctcattcggata
gtcacgcagaacaccgagaacactccatggatgaaaaatgaagggcagagctga

DBGET integrated database retrieval system