KEGG   Mus musculus (mouse): 22072Help
Entry
22072             CDS       T01002                                 

Gene name
Prss2, TRY8, TRYP, Ta, Tesp4, Try2
Definition
(RefSeq) protease, serine 2
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    22072 (Prss2)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    22072 (Prss2)
   04974 Protein digestion and absorption
    22072 (Prss2)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    22072 (Prss2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     22072 (Prss2)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   22072 (Prss2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   22072 (Prss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
6; 6 B1
AA seq 246 aa AA seqDB search
MSALLILALVGAAVAFPVDDDDKIVGGYTCRESSVPYQVSLNAGYHFCGGSLINDQWVVS
AAHCYKYRIQVRLGEHNINVLEGNEQFVDSAKIIRHPNYNSWTLDNDIMLIKLASPVTLN
ARVASVPLPSSCAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLPQADCEASYPGDIT
NNMICVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQPDAPGVYTKVCNYVDWIQ
NTIADN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcacttctgatcctagcccttgtgggagctgctgttgctttccctgtggatgat
gatgacaagattgttggaggatacacctgccgagagagttctgtcccctatcaggtgtcc
ctaaatgctggctaccacttctgtggaggttccctcatcaatgaccagtgggtggtgtct
gcagctcactgctacaaataccgcatccaagtgagactgggagagcacaacatcaatgtc
ctggagggcaatgagcagtttgttgattctgccaagatcatccggcaccccaattataat
tcatggaccctggacaatgacatcatgctgatcaaactggcttcccctgtgaccctcaat
gccagagtggcctctgtacctctgcccagctcctgtgcacctgcaggcactcagtgcctc
atctctggctggggcaacaccctcagcaatggtgtgaacaacccagacctgctccagtgt
gttgatgccccagtgctgcctcaggctgactgtgaggcctcctaccctggggacatcacc
aacaacatgatctgtgttggcttcctggagggaggcaaagattcctgccagggtgactct
ggtggccctgtggtctgcaatggagagctgcagggcattgtctcctggggctatggctgt
gcccagccagatgctcctggtgtatacaccaaggtctgcaactacgtggactggattcag
aacacaattgctgacaactag

DBGET integrated database retrieval system