KEGG   Mus musculus (mouse): 225888Help
Entry
225888            CDS       T01002                                 

Gene name
Kmt5b, AA117471, C630029K18Rik, Suv4-20h1, Suv420h1
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
mmu  Mus musculus (mouse)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    225888 (Kmt5b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     225888 (Kmt5b)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     225888 (Kmt5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
19; 19 A
AA seq 883 aa AA seqDB search
MKWLGDSKNMVVNGRRNGGKLSNDHQQNQSKLQQHSGKDTLKTGRNAVERRSSRCHGNSG
FEGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHISKADSF
SHNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFK
EHVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEE
NMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEP
GEEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLN
RLKKLGDSSKNSDSQSVSSNTDADTTQEKDNATSNRKSSVGVKKSSKSRALTRPSMPRVP
AASNSTSPKLVHTNNPRVPKKLRKPAKPLLSKIRLRNHCKRLDQKSASRKLEMGSLVLKE
PKVVLYKNLPIKKEREPEGPAHAAVGSGCLTRHAAREHRQNHGRGAHSQGDSLPCTYTTR
RSLRTRTGLKETTDIKLEPSPLDGYKNGILEPCPDSGQQPTPEVLEELAPETAHREEASQ
ECPKNDSCLSRKKFRQVKPVKHLAKTEDCSPEHSFPGKDGLPDLPGSHPDQGEPSGTVRV
PVSHTDSAPSPVGCSVVAPDSFTKDSFRTAQSKKKRRVTRYDAQLILENSSGIPKLTLRR
RHDSSSKTNDHESDGVNSSKISIKLSKDHDSDSNLYVAKLSNGVSAGPGSSSTKLKIQLK
RDEESRGPCAEGLHENGVCCSDPLSLLESQMEVDDYSQYEEDSTDESSSSEGEEEEEDCE
DDFDDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagactccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctaatgaccatcagcagaatcaatcaaaattacagcagcactcgggcaaggacacc
ctgaagaccggcagaaacgccgttgagaggcggtccagcagatgtcatggtaactcggga
tttgaagggcagagccgctatgtgccgtcctctggaatgtccgccaaggagctctgtgag
aacgatgacttagcaaccagtttggttcttgatccctacttaggttttcagacacacaaa
atgaacactagcgcctttccttcgaggagctcgaggcatatttcaaaagctgacagtttt
tctcacaacaatcctgtgagatttcggcctataaaaggaaggcaagaagagctaaaggaa
gtaattgaacgctttaagaaagatgaacacttagagaaagctttcaaatgtttgacttct
ggggaatgggcacggcattattttctcaacaaaaacaaaatgcaggagaaattattcaag
gaacatgtctttatttacttgcggatgtttgcaactgacagtggatttgaaatactgcct
tgtaatagatattcttcagaacaaaatggagccaagatagttgcaacaaaagagtggaaa
cgaaatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggag
aacatgctacttagacacggagaaaacgacttcagtgtcatgtattccacaaggaaaaat
tgtgctcaactctggctcggtcctgctgcatttataaatcatgattgcagacctaactgt
aagtttgtgtcaactggtcgagatacagcatgcgttaaggctctgagagatattgaacct
ggagaagaaatttcttgttactatggagatggcttttttggagaaaataatgagttctgc
gaatgttatacttgtgaaagacggggaactggtgcttttaaatcacgagtaggactgcct
gcgcctgctcctgttatcaatagcaaatacggacttagagaaacagataaacgcttaaat
aggcttaaaaagttaggtgacagcagcaaaaactcagacagtcagtctgtcagctctaac
acagatgcagacaccactcaggaaaaagacaatgcaacttctaatcgaaaatcttcagtt
ggtgtgaaaaagagcagcaagagtcgagctctgacaaggccgtccatgccgagagtcccg
gctgcttccaactctacctcacccaagctagtgcacaccaacaatccccgggtaccaaag
aaactgagaaagccggcaaagcctttactctccaagatcagactgcggaatcactgcaag
cggctggaccagaagagcgcatcccgcaagctcgagatggggagcttagtgcttaaggag
cccaaagtcgtgctatataaaaatttgccaattaagaaagaaagggagccagagggacca
gcccatgctgcagtggggagtgggtgcttgactagacatgctgcgagagaacacaggcag
aatcatgggagaggtgctcattcgcagggcgacagtttgccctgcacctacacaacccgg
cgctctttgaggacaaggacaggtctgaaggagaccactgacatcaagcttgaaccaagt
cccttggatggctataaaaatggtatactggaaccttgcccagacagtggccagcagcca
accccagaggtgctggaagaactggctcctgagactgcacacagggaggaagcatcccag
gagtgtcccaagaacgactcctgcctgtcacgaaagaaatttcgacaagtgaaacctgtg
aaacacttagcaaagaccgaggactgcagtccagagcacagcttccctgggaaagacggg
ctgccagatttgccagggtctcatcctgatcaaggtgagcccagtggcacagtcagggtg
cccgtgagccacacggactctgctccctcaccggttggctgctctgttgtcgcacccgac
agcttcacaaaagacagcttcagaactgcacaaagtaaaaagaagcggcgggtcaccagg
tacgatgcacagctgatcctggagaacagctctggaatccccaagctgacgcttcgcagg
cggcacgacagcagcagcaagacaaacgaccatgagagtgacggcgtgaactcctccaag
atcagcatcaaactcagcaaggaccacgacagtgacagcaacctctatgttgccaagctc
agtaacggggtcagcgcagggccgggcagcagctccaccaagctcaagatccagctcaag
cgggatgaggagagcagggggccatgtgcagagggcctgcacgagaacggggtgtgctgc
agcgaccccctctccctgctcgagtcccagatggaggtggacgactacagtcaatatgag
gaggacagcacagatgaatcctcatcttctgagggggaggaggaggaggaggactgcgag
gatgacttcgatgatgacttcattcctcttcctccggcaaagcggctgaggctaattgtt
ggtaaagactccatagatattgacatttcttcaaggagaagagaagatcagtctctaaga
ctgaacgcatga

DBGET integrated database retrieval system