KEGG   Mus musculus (mouse): 233870Help
Entry
233870            CDS       T01002                                 

Gene name
Tufm, 2300002G02Rik, C76308, C76389, EF-TuMT, EFTU
Definition
(RefSeq) Tu translation elongation factor, mitochondrial
  KO
K02358  elongation factor Tu
Organism
mmu  Mus musculus (mouse)
Brite
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Elongation factors
   233870 (Tufm)
 Prokaryotic Type
   233870 (Tufm)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    233870 (Tufm)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   233870 (Tufm)
  Exosomal proteins of breast cancer cells
   233870 (Tufm)
  Exosomal proteins of colorectal cancer cells
   233870 (Tufm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 233870
NCBI-ProteinID: NP_766333
MGI: 1923686
Ensembl: ENSMUSG00000073838
Vega: OTTMUSG00000058216
UniProt: Q8BFR5
LinkDB All DBs
Position
7; 7 F3
AA seq 452 aa AA seqDB search
MAAATLLRATPRFSGLCASPTPFLQGRLRPLKAPASPFLCRGLAVEAKKTYVRDKPHVNV
GTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAAR
HYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHVVVYV
NKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEQRDPELGVKSVQKLL
DAVDTYIPVPTRDLDKPFLLPVESVYSIPGRGTVVTGTLERGILKKGDECELLGHNKNIR
TVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIQPHQKVEAQVYILS
KEEGGRHKPFVSHFMPVMFSLTWDMACRVILPPGKELAMPGEDLKLSLILRQPMILEKGQ
RFTLRDGNKTIGTGLVTDVPAMTEEDKNIKWS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagccactctattgcgagcgacgccccgcttcagcggtctctgcgccagcccg
accccatttctgcaaggtcggctgcggccgctgaaggctcccgcatcacccttcttgtgt
cgcggcctagctgtggaggccaagaagacttatgtacgcgacaagccccatgtgaatgtg
ggtaccatcggacatgtggaccatggcaagaccaccctgactgcagccatcacgaaaatt
ctagccgagggaggtggagctaagttcaagaagtacgaggagatagacaatgccccagag
gagcgagctcggggcatcaccatcaatgcagcccatgtggagtatagcactgctgcccga
cactatgcccacacagactgtcctggtcatgcagattatgttaagaatatgatcacaggc
actgcccccctggatggctgtatcctggtggtggcagctaatgatggccccatgccccag
acccgagagcacttactgctagctaaacagattggggtagaacatgttgtggtgtacgtg
aacaaggcagacgctgtccaggactcagagatggtggagttagtcgagctggagatccgg
gagctgctcaccgagtttggctataaaggagaggaaactccagtcatcgtaggctcggct
ctctgtgcccttgagcaacgtgaccctgagctaggcgtgaagtcagtgcagaagctcctg
gatgctgtggacacctacatcccagtgcccacccgggacctggacaagcccttcctgctc
cctgtagagtcagtctactctattcctggccggggcacagtggtgacaggtacattagag
cgtggcattttgaagaaaggagatgagtgtgagttgctgggacataacaagaacatccgc
actgtggtgacaggcattgagatgttccacaagagcctggagagggctgaggcaggggat
aacctgggtgctctggtccgaggcttaaagcgcgaagatttgaggcgtggcttggtcatg
gtcaagccaggctccatccaaccccaccagaaggtggaggcccaggtttatatcctcagc
aaggaggaaggtggccgccacaaaccctttgtatctcatttcatgcccgtcatgttctcc
ctgacctgggacatggcctgtcgagtcatcttgcctccagggaaggaacttgccatgcct
ggagaggacttgaagcttagtctaatcttgcggcagcccatgatcttagagaaaggccaa
cgtttcaccttgagggatggcaacaagaccattggcactggccttgttactgatgtacca
gccatgactgaggaggacaagaacatcaagtggagctga

DBGET integrated database retrieval system