KEGG   Mus musculus (mouse): 432478Help
Entry
432478            CDS       T01002                                 

Gene name
Tmprss9, Serase-1B
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     432478 (Tmprss9)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   432478 (Tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 SEA Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 432478
NCBI-ProteinID: NP_001075157
MGI: 3612246
Ensembl: ENSMUSG00000059406
UniProt: D3YTR8
LinkDB All DBs
Position
10; 10 C1
AA seq 1099 aa AA seqDB search
MEPTAPDLQLVPEVTKAVSVSAPDPGPCRTAVIAVVGISMAIVTLGVLSAFFSAQGAHVE
HIAELHGIRFTSSLQQENSDFYRLLTHALQTLFVSSFQKTELESSCAGCTVLSYRDGNST
VIVHFRLHFLLRALQPLSLKQEADILQKGIQARLQEQGLSLAAYGTIVSVELTGRCEGPV
TERDLKSGHCPGNVFSCQNGQCVSKENPECDDRVDCSDESDEAQCDCGWQPAWRSAGRIV
GGVEAAPGEFPWQVSLRENHEHFCGATIIGARWLVSAAHCFNEFQDPAQWAAQAGSVHLS
GSEASAVRTRVLRIAKHPAYDADTADFDVAVLELARPLPFGRYVQPACLPAATHVFPPGK
KCLISGWGYLKEDFLVKPEVLQKATVELLDQSLCSSLYGHSLTDRMVCAGYLDGKVDSCQ
GDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGVYTRVTRLRDWILEVTSAADMPVVP
TATPAPATPSTPWPTSPESWAPNTFAKPTAAPSPVPLHPSTTAKPQECGARPAMDKPTRI
VGGISAVSGEVPWQASLKEGPRHFCGATVVGDRWLLSAAHCFNHTKVEQVQAHLGTVSLL
GVGGSPVKLGLRRVALHPRYNPGILDFDVALLELAQPLVFNKYIQPVCLPLAIHKFPVGR
KCMISGWGNMQEGNATKPDILQKASVGIIEQKMCGALYNFSLTDRMLCAGFLEGRVDSCQ
GDSGGPLACEETPGVFYLAGIVSWGIGCAQAKKPGVYARITRLKDWILKAMSSDPSSMAR
PHTSSTRLIPSEPPKTTAAGLIIPEATTSRLATPRATIRVTTRPLNTTLSARSTTTRGQT
AAPSAPGTTIHSHLPDCGLAPPGALTRIVGGSAASLGEWPWQVSLWLRRREHRCGAVLVA
ERWLLSAAHCFDIYGDPMQWAAFLGTPFLSSTEGQLERVARIYRHPFYNIYTLDYDVALL
ELAGPVRRSRLVRPICLPGPARPPDGARCVITGWGSLREGGSMARQLQKAAVRVLSEQTC
RRFYPVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPSGQWVLTGVTSWGYGCGRPHFP
GVYTRVAAVLGWIGQNIQE
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atggagcccactgcaccagacttacaacttgtgccagaggtgacaaaggctgtctctgta
tctgctccagaccctggcccttgtcgaacggctgtcatcgcagtggtgggcatcagcatg
gccatcgtgaccctgggagtcctttcagccttcttctccgcacagggcgcccacgtggag
cacatagcagagctacatgggatccgtttcaccagttctttgcagcaggagaactctgac
ttctaccgcctactcacgcatgctctgcagacactgtttgtgagtagtttccagaaaaca
gagttagagtcgagctgcgcaggctgcaccgtgcttagttacagggatggcaattccact
gtgattgtacatttccggctacactttctgctccgagccctccagcccctgagcctgaag
caggaagcagacatcttgcagaaaggaatccaggcaaggctgcaggaacaaggtctttcc
ctggctgcctatggcaccatcgtgtcagtcgagctgacaggaaggtgtgaaggtccggtg
actgagagggacttaaagtcaggccactgccccgggaatgtcttctcctgtcagaatggt
cagtgcgtgagcaaagagaacccggagtgtgatgacagagtggactgctccgacgagtct
gatgaggctcagtgcgactgcggctggcagcctgcctggaggtcagctggcaggatcgtg
ggaggagtggaggcggctcccggggagttcccctggcaggtcagtcttcgagagaatcac
gaacacttctgtggcgccaccatcatcggtgccaggtggctggtgtctgctgcccactgc
ttcaacgaattccaggaccctgcgcagtgggccgcccaggcgggcagtgtgcacctgagc
gggtcagaggccagcgctgtgcgcacacgcgtgctccgcatagccaagcatcctgcctat
gatgcggacacagcggacttcgacgtggcggtgctggagctggcgcgcccgctgcccttc
ggacgctatgtgcagcctgcctgcctccccgcggccacgcacgtcttcccgccgggcaag
aagtgtctgatctcgggctggggttacctgaaagaggacttcctggtgaagccagaggtc
cttcagaaagccacggtggaattgctggaccagagcctgtgttccagcctgtacggccac
tcgctcaccgacaggatggtgtgtgccggctacctggacgggaaggtagactcctgccag
ggggactccgggggacccctggtctgcgaggagccttcaggaaggttcttcctggctggt
atcgtgagctggggaatcggctgcgcagaagcgcggcgcccaggggtctacacccgagtc
accaggctgcgggattggatcttggaggtgaccagcgctgctgacatgcctgtggtcccc
accgcgactccagcgcccgccacccccagcactccctggcctaccagccctgagagctgg
gcgcccaacacctttgccaaacccaccgctgcccccagccctgtgccactgcaccccagc
actacggccaagccacaagagtgtggggccagacccgccatggacaagcccactcggatt
gtgggcgggatcagcgccgtgtctggggaggtgccctggcaggccagcctgaaggaagga
cccagacatttctgcggagccaccgtggtgggtgaccgctggctgctgtctgccgcccac
tgtttcaaccacaccaaagtggagcaggtgcaggcgcacctgggcaccgtgtccctgctg
ggtgtcggcgggagccccgtgaaactggggctccgaagggtggccctgcatccccgctac
aacccaggaatcctggactttgacgtggccctgctggagttagcccagccattggtcttc
aacaagtacatccaaccggtttgtctgcccctggccatccacaagttcccagtcggccgg
aagtgtatgatctcaggctggggcaacatgcaggagggaaatgccaccaagcctgacatc
ttgcagaaggcgtccgtgggcatcatagagcagaagatgtgtggagccctgtacaacttc
tccctcactgaccgcatgctctgtgctggcttcctggagggcagagttgactcctgccag
ggtgattctggtggccccttggcatgtgaagagacacctggtgtcttttacctggctggc
atcgtgagctggggcattggctgtgcccaggctaagaagcctggcgtatatgcacgaatc
acacgcctcaaggactggatcctgaaagcgatgtcctcagaccccagctccatggctcgc
ccccacacctccagcacacggctcatccctagtgagccccccaaaaccacagctgctggc
ctcattatcccagaggccaccaccagcagacttgctacccccagggccaccatcagagtg
accactagaccactcaacacaacactgtctgccaggagtaccaccaccaggggacagaca
gcagccccaagtgcaccgggcaccaccatacactctcacctgccagattgtggcctggca
ccccccggggccctgacccggatagtgggcggcagcgcagcctcgcttggggagtggccc
tggcaagtgagcctgtggctgcggcgcagggagcaccgatgtggggcggtactggtggcc
gagaggtggcttctgtctgcagcacactgtttcgacatctatggggaccctatgcagtgg
gcggccttcctgggcaccccattcctgagcagcacggagggccagttggagcgcgtggca
cgcatctatcgccacccgttctacaacatctacacactggactatgacgtggcactgctg
gagctggcgggacccgtgcgccgcagccgcttggtgcgacccatctgcctaccaggtccc
gcaaggccccctgacggcgctcgatgcgtcatcaccggctggggctcgctgcgcgaggga
ggctccatggcgcggcagctgcagaaggccgcagtaagggtcctcagtgaacagacatgt
cgccgcttctacccagtgcagatcagcagccgtatgttgtgtgcaggcttcccacagggt
ggcgtggacagctgctcgggtgatgcagggggacccctggcctgcagggagccatctggc
caatgggtgctaactggggtcaccagctggggctacggctgtggcaggccccacttccca
ggtgtctacactcgagtggctgctgtgctgggatggataggccagaacatccaggaatga

DBGET integrated database retrieval system