KEGG   Mus musculus (mouse): 74176Help
Entry
74176             CDS       T01002                                 

Gene name
Tgm5, 2310007C07Rik, TGMX, TGx
Definition
(RefSeq) transglutaminase 5
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     74176 (Tgm5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
2; 2 E5
AA seq 724 aa AA seqDB search
MAQGCPITGLEVALTDLQSSQNNVRHHTEEISVDRLVVRRGQAFSITLYFKNRGFQPGMD
SIMFVAETGPLPDLAKGTRAVFSFTGSGGPSPWIASLEANRANSLEVSLCAPPIAAVGRY
LLKIRIDSYQGFVTAYQLGEFILLFNPWCPADSVYLESEPQRQEYVVNDYGFIYQGSKSW
IRPCPWNYGQFEENIIDICLELLEKSLNFQVDPSTDCALRGSPVYTSRVVCAMINSNDDN
GVLNGNWSENYVDGINPAEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIP
TRVITNFDSGHDTDGNLIIDEYYDNTGRILENMKKDTVWNFHVWNECWMARKDLPPGYGG
WQVLDATPQETSNGLYCCGPASVKAIKEGEIDLNYDTRFAFSMVNADCMSWLVYGGKEQK
LHQDTATVGNFISTKSIQSDERDDITESYKYEEGSLQEREVFLKALQKLQATRSQGPHQA
NSNPFSSVPPRHNSARSPDSPSLQPSDVLQVSLKFELLDSPKMGQDINFVLLAVNMSPQF
KDLKLNLSAQSLLHDGSPLVPFWQDTAFITLFPEEEKSYPCKILYSQYSQYLSTDKLIRI
SALGEEKNSPEKILVNKIITLTFPGIMINVLGAAFVNQPLTVQVVFSNPLSEPVEDCVLT
LEGSGLFRKQQRVLIGVLKPHHKASITLKTVPFKSGQRQIQANLRSNRFKDIKGYKNVYV
DIGL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaggctgccccatcacaggactagaggtggccctcacagacctccagagctcc
cagaataatgttcggcaccacacggaagagatcagtgttgaccggcttgttgtccgccga
ggccaggccttctccatcaccctgtactttaagaatcggggcttccagccaggcatggac
agtatcatgtttgtggctgagactggacccttgcccgatctggccaaagggactcgggca
gtattcagcttcacaggcagtggtggcccaagcccctggattgcgtccctggaagccaac
agggccaactccctggaagtgagcctctgtgctcctcccatagcagccgtgggccgatac
ctcctgaaaattcggatcgactcctaccagggttttgtcactgcctaccagctgggggag
tttatcctgctcttcaatccctggtgcccagcggattcagtgtatctggagagtgagccc
cagaggcaggagtatgttgtgaacgattatggcttcatctaccaagggagcaagagttgg
atccgcccatgcccctggaactatgggcagtttgaagagaatatcatagatatctgcttg
gagctgctagagaagagcctgaacttccaggttgacccatccacagactgtgcccttcgg
ggaagccctgtctacaccagcagagttgtgtgtgccatgataaacagcaatgatgacaac
ggagtgctcaatggcaactggagtgagaattatgtggacggcatcaaccccgcggaatgg
actggcagcgtggccatccttaagcagtggcatgccacaggctgccaaccagtgcgctat
gggcaatgctgggtctttgctgctgtcatgtgcacagtgatgaggtgcctggggatcccc
acccgcgtgatcaccaactttgactctggccatgacaccgatgggaacctgatcattgat
gagtattacgacaacacaggcaggattctggagaatatgaagaaggacaccgtctggaat
ttccatgtgtggaatgagtgttggatggcacgcaaggacctccctcctggatacggaggc
tggcaggtgcttgatgctacacctcaggaaaccagcaatggtctctactgctgtggccct
gcttctgtcaaagccatcaaagagggagaaattgatctaaactatgacacacgctttgca
ttttctatggtgaatgctgactgcatgtcctggcttgtctatggcgggaaggagcagaaa
cttcaccaggacacagctactgttgggaattttatcagcaccaagagcatccagagtgat
gagcgtgatgacatcaccgagagctacaagtatgaagaaggttcccttcaagagagagag
gtgttcctaaaggctctgcagaagctacaggctacaaggtctcaagggcctcaccaagca
aactccaatcccttcagctccgtgccaccaaggcacaacagtgccaggagtcctgattca
ccttcccttcaacccagtgatgtcctccaggtctctctgaagtttgagctgctcgactca
cccaaaatgggccaagacataaactttgtcctgttggctgtcaatatgtcacctcagttc
aaggatctcaaactcaacttgagtgcccagtctctgttgcatgatggcagccccctggtt
ccattctggcaggacacagcattcatcacactgttccctgaagaagaaaagagctaccct
tgcaaaatcctctactcacagtacagccagtatctgtcgacggacaagctaatccgcatc
agtgccctgggtgaagagaagaacagtcctgagaaaatcctggtgaacaagatcatcacc
ttgactttcccgggcatcatgattaatgttctaggagctgcctttgtgaatcagccgctc
acagtccaggtggtcttctcaaacccgctctcagagccggttgaggactgtgtgctgacc
ttggaaggaagtggtctctttagaaagcagcagagagttctcattggcgtcctcaaaccc
catcacaaagccagcatcactctgaagaccgtccccttcaagagtggccaaaggcagatc
caagctaatctgaggagcaataggtttaaagacatcaagggctacaagaacgtgtatgta
gacattggcttataa

DBGET integrated database retrieval system