KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_13480Help
Entry
MYCMA_13480       CDS       T02177                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AIC73073
LinkDB All DBs
Position
4423308..4424372
Genome map
AA seq 354 aa AA seqDB search
MDLPVMPPIAPMLAKPVAKIPDGASYEPKWDGFRSIVFRDGDEVELGSRNEKPLTRYFPE
LVAAVLAELPPRCVVDGEIVIATEAGLDFEALQQRIHPADSRVRLLAEQTPSSFIAFDLL
ALGDEDYTGRPFSERRAALAEALSGAGASIHLTPATTDQALAQRWFEEFEGAGTDGLIAK
PLAIAYQPDKRVMFKIKPERTADCVVAGYRVHKSGDNAIGSLLLGLYQEDGVLASVGVIG
AFPMAERKRLFQELQPLVIPLENHPWNWAAHEAGERTPQKNAGSRWNAGKDLSFVPLRPE
RVVEVRYDHMEGVRFRHTAQFNRWRPDRDPRSCTYEQLEQPITFSLNDIVPGLV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtcatgcctccaatcgcgccaatgcttgccaaacctgtcgcaaaaatc
cctgacggcgcctcctacgaacccaagtgggatggattcaggtcgatcgtctttcgcgac
ggcgacgaggtggagctgggtagccgcaacgagaagccactgacccggtacttccccgag
ttggtagcggcggtgctcgccgaactaccgccacggtgtgtcgtcgacggtgagatcgtg
atcgccaccgaagcgggtctggatttcgaggcgctgcaacaacggatccacccggctgat
tcgcgggtacggctattggccgagcagacaccctcctccttcatcgcattcgacctgctc
gccttgggcgacgaggactacaccgggcggcccttcagcgagcgccgtgccgcgctggcg
gaggcattgtccggcgcgggtgcgtcgattcacctcacgcccgccaccacagatcaggca
ctggcgcagcgctggttcgaggaattcgagggcgccggcaccgacggtctcatcgcgaag
ccgttggccatcgcctaccaacccgacaaacgagtgatgttcaagataaagccggagcga
accgcggattgcgtggtcgcgggctaccgagtgcacaaatcgggtgacaatgccatcggc
tcgctgctgctgggcctgtaccaggaggacggcgtattggcgtcggtcggtgtgatcggc
gcgttccctatggccgaacgcaagcgcctattccaagaactacaaccgttggtcatcccg
ctcgaaaatcacccatggaactgggccgcacacgaagccggcgagcgcactccgcagaag
aacgccggctcccgctggaacgcgggcaaggatctttcgttcgtcccgctgcgtcccgag
cgggtggtggaggttcgctacgaccacatggagggtgtgcggttccgccataccgcgcag
ttcaaccgctggcgcccggatcgcgacccgcgatcctgcacctacgagcagctagaacaa
ccaattacattcagcctcaacgatattgttccaggtctggtgtga

DBGET integrated database retrieval system