KEGG   Marinomonas sp. MWYL1: Mmwyl1_0065Help
Entry
Mmwyl1_0065       CDS       T00567                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mmwyl1_0065
Enzymes [BR:mmw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Mmwyl1_0065
Transporters [BR:mmw02000]
 Other Transporters
  Pores ion channels [TC:1]
   Mmwyl1_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ABR69007
JGI: Mmwyl10065
UniProt: A6VRC8
LinkDB All DBs
Position
70965..71606
Genome map
AA seq 213 aa AA seqDB search
MSEIQSNQDTITLYHAPQTRGTGIWVLLEELGIPYDMKVLNFKAGENQQPEFLAINPLGK
FPTLVHNGTVVTEQVACYTYLADLFPEKGLAPAFNDPKRGAYLRWMAYQGSSFEPAVIDK
AFNRPEVAASQSSYGSFDKMLQTLFDQIAKGPYLLGEELYAVDILWGLSLKWCRMFGLIT
TNPVVDAYIERVTSRSSFTRVEEKEQALLLAQS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagattcaaagcaaccaagacaccatcaccctgtaccatgctccacaaacccga
ggcactggcatttgggtattgctggaagagttggggattccctatgacatgaaagtgctg
aatttcaaagccggtgaaaatcaacaaccagagtttctcgctatcaatcctttggggaaa
tttccaacccttgttcataacggcactgtggttacagaacaagttgcttgttacacctac
ttggccgatctgtttcctgaaaaaggcttagcgcctgctttcaatgatccaaaacgtggt
gcgtatttacgctggatggcttaccaaggcagcagttttgagcccgccgtgatcgacaaa
gcgtttaatcgccctgaagtcgcagcgtctcaatcatcctatggcagctttgataaaatg
ctgcaaacgctattcgatcaaatcgccaaaggcccttatttattgggagaggagctgtac
gcagtggatattctttggggattgagtttgaaatggtgccgcatgtttggactcattacg
acgaatccagtggtcgacgcttacattgaacgtgtcacctctcgttcttccttcacaagg
gtggaggaaaaagagcaagctttgttgcttgcccagtcataa

DBGET integrated database retrieval system