KEGG   Methylobacterium nodulans: Mnod_1171Help
Entry
Mnod_1171         CDS       T00839                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mno  Methylobacterium nodulans
Pathway
mno00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Mnod_1171
Enzymes [BR:mno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Mnod_1171
Transporters [BR:mno02000]
 Other Transporters
  Pores ion channels [TC:1]
   Mnod_1171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 GST_C_6 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ACL56177
JGI: Mnod1171
UniProt: B8IJG2
LinkDB All DBs
Position
1239041..1239655
Genome map
AA seq 204 aa AA seqDB search
MQIFGDLVSGNCLKVRYVADHLGLPYTWVPVDIMKGESRTPEYLARFPAGQVPGIVFPDG
RCLAQSNAIIRYLARSSALLPEDPWIQAKIDEWLFWEQYSHEPTIAVCRFQMRYRGEPAA
MRDPRKVAGGEAALDLMERRLVAADWFAGETFTIADIALFAYTQFADEGGFSLAARPAVR
AWLKRCMQALGLPRDEPTPPAALS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatcttcggcgacctagtgtcgggcaattgcctcaaggtgagatacgtcgccgat
catctcggcctgccctatacttgggtgcccgtcgacatcatgaagggcgagagccgcacg
cccgaatacctcgcccgctttcccgccgggcaggtgcccggaatcgtctttccggacggg
cgctgcctcgcgcagtcgaacgccatcatccggtacctcgcccgcagcagcgcgctcttg
ccggaggatccctggatccaggccaagatcgacgagtggctgttctgggagcagtacagc
cacgagcccaccatcgccgtctgccgcttccagatgcgctacaggggcgagcccgccgcg
atgcgcgacccccggaaggtggccggcggcgaggcggccctcgacctgatggagcgacgc
ttggtcgccgcggattggttcgcgggcgagaccttcaccatcgcggacatcgccctcttc
gcctatacgcaattcgccgacgagggcggattcagcctcgccgcgcggccggccgtgcgc
gcttggctcaagcgttgcatgcaggctctcggcctgccgcgtgacgaaccgacacctccc
gccgcactctcctga

DBGET integrated database retrieval system