KEGG   Methylobacterium nodulans: Mnod_5366Help
Entry
Mnod_5366         CDS       T00839                                 

Definition
(GenBank) Glutathione S-transferase domain protein
Organism
mno  Methylobacterium nodulans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C GST_N_4 GST_C_5 Tom37
Motif
Other DBs
NCBI-ProteinID: ACL60211
JGI: Mnod5366
UniProt: B8IML8
LinkDB All DBs
Position
5447842..5448465
Genome map
AA seq 207 aa AA seqDB search
MILYGSSLSPFVRKVLVALFEKGLAFEHIPVRFHDPDQDFRASSPLGKIPALCDGEVRLA
DSSAIIHYLDRAHPLKPLLPADARALGRTIWFDKFADTELIGPLLRPFVHRVLRPRVLNL
PGDEAVVRKALDEDQPRLFGYLETQIHGPYLVGEAFSLADIAVGTGFVNLRSAGEAVDAD
RFPKLAAWVAATLERASFKAAIAARKG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgatactctacggcagcagcctgtcgcccttcgtgcgcaaggtcctggtggcgctgttc
gagaagggcctcgccttcgagcacatcccggtgcgcttccacgatcccgaccaggacttc
cgggcgtcgagcccgctcgggaagatcccggccctctgcgacggtgaggtccgcctcgcc
gattcctccgccatcatccactacctggaccgtgcccacccgcttaagcctctgctgccc
gccgatgcccgcgccctcggccgcacgatctggttcgacaagttcgccgacacggagctg
atcgggccgctgctgcggcccttcgtgcaccgggtgctgaggccgcgcgtcctcaacctg
ccgggcgacgaggcggtggtgcgcaaggccctcgacgaggaccagccgcggctcttcggc
tatctggagacgcagatccatgggccctacctggtcggggaggcgttcagcctcgccgac
atcgcggtcgggaccggcttcgtgaacctgcgcagcgcgggcgaggccgtcgatgccgac
cgcttcccgaagctcgccgcctgggtggccgcgaccctcgagcgggcctcgttcaaggcc
gcgatcgcggcccggaagggctga

DBGET integrated database retrieval system