KEGG   Methylobacterium nodulans: Mnod_8079Help
Entry
Mnod_8079         CDS       T00839                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
mno  Methylobacterium nodulans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
pMNOD02:303804..306653
Genome map
AA seq 949 aa AA seqDB search
MRDEALHPSSATEPGQQPGAASLLDVIRSLLRELHPERRRPLAVDLDSDLERDLALDSLG
RAELLLRLSRAFRVTLPDRLIGEAATPADLLAAVQAAGAARCPGATFPRDEALSPAAEPH
GAATLPEVLAFHVRRNPDRPHLRLWQGPDHETIVTYAALDDAARRVAGGLLEAGLAAGGR
VAIMLPTGPDFFPAFFGVLLAGGIPVPLYPPFRRAQIQDHLQRQARILSNAAPEILITDG
EIKPFARLLPGLVESLRTLTTVEELATAAPLAATVPATGTTVALIQYTSGSTGDPKGVTL
THANLLANIRAIGEALGATSADVVVSWLPLYHDMGLIGCWLGSLYFGAPAVIMPPLSFLA
DPGRWLRAIHRHRATISAAPNFAYELCLKTLRDEDLAGLDLGSLRVLTNGAEPVSSDTLS
RFAQRFTAFGLRPSALTPVYGLAECAVGLAFPPPGRGPLIDWIDRTALSRQGEARPAAPG
NAKSIAFAACGRPLRGHQIRIVDEAGREVPERVEGRLQFRGPSATAGYFRNPEKTQALFD
GEWLESGDLAYEAGGDVFITGRLKDIVIRAGRKIHPHELEEVAGSVPGVRKGCVAAFASP
DPKTGTERLILVAETRLTDASARAGLRRTLAEAAAGVLDQPPDDILLCPPHTVPKTSSGK
IRRAAARALYESGGLDRPDSIRAQVAGLALAGIGARLRRIARLAREAGYAAQWWAVLVGL
GIVLWPVVIMLPRRAWRHAALRAGLRAFFRLTGTPVLVEGGTATPPAIIAANHASYLDAA
VLAAVLPGTPVFLAKHELAGQAVAGPFLRRLGTVFVHRGEAAGVSDADVVLDRIRAGEQI
VAFPEGTFTRTPGLLGFHLGAFMTACRAGVPVAPIAITGTRSLLRADQWFPRHGAIRVHL
GQKIAPEGADFHAAVRLRDAVRAAILARCGEPDLADEPVSLPAAPSAPG
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
ttgagggacgaagctctgcacccgagcagcgcgaccgagccgggacagcagccgggcgct
gcgtcgctcctcgacgtgatccggtcgctcctgcgcgagctgcatccggagcgccggcgt
cccctcgcggtggacctcgacagcgatctcgagcgggatctcgccctcgacagcctcggc
cgagccgagcttctgctgcgcctgtcgcgcgccttcagggtcaccctgccggatcgcctc
atcggcgaggccgccacgccggccgacctgctcgcggccgtccaggccgccggcgcggcg
cgatgcccgggcgccacattcccccgcgacgaggccctttctccggcggccgagccgcac
ggagccgcgacgctgccggaggtgctcgctttccacgtccgccgtaatccggaccggccc
catctgcggctctggcaggggcccgaccacgagaccatcgtcacctacgcggccctcgac
gacgcggcccggcgcgtggcgggcggtctcctcgaggccgggctcgccgctggcggccgc
gtcgccatcatgctcccgaccgggccggacttcttccccgccttcttcggcgtccttctg
gccggcgggatcccggtccccctctacccgcccttccggcgcgcccagatccaggaccac
ctgcagcggcaggcccgcatcctgtcgaacgccgccccggagatcctgatcaccgacggc
gagatcaagcccttcgcccgcctcctgcccggcctcgtcgagagcttgcggaccctgacg
acggtggaggaactggctacggctgcccctttggcggcaaccgtcccggcgacgggcacg
accgtcgccctgatccagtacacctccgggagcaccggcgacccgaagggcgtgacgctc
acgcacgccaatcttctcgccaacatccgcgccataggggaagctctcggcgccacgtcg
gcggacgtggtggtgagctggctgcccctctaccacgacatggggctgatcggctgctgg
ctggggagcctctacttcggcgcgccggccgtgatcatgccgcccctgtccttcctggcg
gatccggggcgctggctccgggcgatccatcggcaccgcgcgacgatctcggccgcgccc
aacttcgcctacgagctctgcctcaagaccctgcgcgacgaggatctcgcgggcctcgac
ctcggctccctgcgcgtcctcaccaacggggccgagccggtgagctccgacacgctgagc
cgcttcgcgcagcgcttcaccgcgttcggtttgcggccatccgccctgacccccgtctac
ggcctcgccgaatgcgcagtcggactggcgtttcctccgcctggccgaggcccgctgatc
gactggatcgaccgcactgcgctgtcgcgccagggagaggctcgtccggcagcgccaggc
aacgccaagtccatcgccttcgcggcctgcggacgccctttgcggggtcatcagatccgc
atcgtggacgaggccgggcgcgaggtgcccgagcgcgtggagggccggctgcagttccgg
ggcccctccgcgaccgcgggctatttccgcaatcccgagaagacgcaggccctgttcgac
ggcgagtggctggagagcggcgacctcgcctacgaagcgggcggcgacgtcttcatcacg
ggccgcctcaaggacatcgtcatccgggcggggcggaagatccatccgcacgaactcgaa
gaggtcgcgggctcggtcccgggcgtgcgcaagggctgtgtcgctgccttcgcgagcccc
gacccgaagaccggcacggagcggctgatcctcgtcgccgagacgcggctgacggacgcc
tccgcccgcgccgggctgcgccgcacgctggcggaggccgccgccggcgtgctcgaccag
ccgcccgacgacatccttctgtgtccgccgcacacggtgccgaagacctcgagcgggaag
atccggcgtgcggccgcgcgggcgctctacgagtcgggcggcctcgaccgcccggattcc
attcgggcgcaagtcgcgggcctcgccctcgccgggatcggcgcacgcctgcgccggatc
gcgcggctcgcccgggaggcgggctacgccgcgcagtggtgggccgtgctcgtcggcctc
ggcatcgtcctgtggccggtcgtcatcatgctcccgcgccgggcgtggcgccacgccgcc
ctgcgggcgggcctgcgtgccttcttccgcctcacgggaacgccggtcctggtcgagggc
ggcacggcgacgccccccgcgatcatcgcggccaaccacgccagctacctcgatgccgcg
gtgctggcggccgttctgcccggcacgccggtcttcctcgccaagcatgagctggcgggc
caggccgtggcgggtccgttcctgcggcggctcggaacggtgttcgtgcaccgcggcgag
gcggccggcgtctcggatgcggacgtggtcctcgaccggatccgggcgggggagcagatc
gtggcgtttccggagggaaccttcacccgcacgcccggcctcctcggcttccacctcggc
gctttcatgacggcgtgccgcgccggggttccggtcgctcccatcgcgatcacggggacc
cgctcgctcctgcgcgccgatcagtggttcccgcggcatggcgcgatccgcgtccatctc
ggccagaagattgcccccgagggggccgactttcacgcggccgtccggctgcgcgacgcg
gttcgcgcggcgatcctcgcgcggtgcggcgagccggatctcgcggacgagccggtgagc
ctgcccgccgcgccctcggcgccgggctga

DBGET integrated database retrieval system