KEGG   Massilia sp. NR 4-1: ACZ75_11520Help
Entry
ACZ75_11520       CDS       T04026                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mnr  Massilia sp. NR 4-1
Pathway
mnr00020  Citrate cycle (TCA cycle)
mnr00480  Glutathione metabolism
mnr01100  Metabolic pathways
mnr01110  Biosynthesis of secondary metabolites
mnr01120  Microbial metabolism in diverse environments
mnr01130  Biosynthesis of antibiotics
mnr01200  Carbon metabolism
mnr01210  2-Oxocarboxylic acid metabolism
mnr01230  Biosynthesis of amino acids
Module
mnr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mnr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mnr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACZ75_11520
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ACZ75_11520
Enzymes [BR:mnr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ACZ75_11520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AKU21999
UniProt: A0A0K1JY20
LinkDB All DBs
Position
complement(2873920..2875173)
Genome map
AA seq 417 aa AA seqDB search
MYQHIKVPADGQKITVNADFSLTVPDQPIIPFLEGDGTGVDITPVMIKVVDAAVAKAYAG
KRKISWMEIYAGEKSTNVYGPDVWLPEETLQVLKDYVVSIKGPLTTPVGGGIRSLNVALR
QELDLYVCLRPVRYFAGVPSPVREPEKTDMVIFRENSEDIYAGIEWQEGSEGAKKIIEFL
TKEMGVKKIRFPETSGIGVKPVSREGTERLVRKAIQYAIDNDKPSVTIVHKGNIMKYTEG
GFRDWAYALAQKEFGAELIDGGPWCKFKNPKTGREIIVKDSIADAFLQQILLRPAEYSVI
ATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSLILS
AEMMLRHMGWTEAADLIISSMEKAITSKKVTYDFARLMEGATQVSCSGFGDVMIEQM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaacatatcaaagtacctgctgacggccagaaaatcaccgtcaacgccgacttt
tccctgaccgttcctgaccagcctatcattccattcctggaaggtgacggcaccggtgtt
gacatcaccccagtgatgatcaaggtggtggacgctgccgtggccaaagcctacgccggc
aagcgcaagatcagctggatggaaatctacgctggcgagaaatcgaccaatgtatacggc
ccggacgtgtggctgccggaagaaaccctgcaggtactgaaagactacgtcgtttcgatc
aaaggcccactgaccaccccggtcggcggcggcatccgttcgctgaacgtggccctgcgc
caggaactggacctgtacgtctgcctgcgcccagtgcgctacttcgccggcgtgccatcg
ccagtgcgtgagccggagaaaaccgacatggtcatcttccgcgaaaactcggaagacatc
tacgccggcatcgaatggcaagaaggctccgaaggcgccaagaaaatcatcgaattcctg
accaaggaaatgggcgtcaagaagatccgcttcccggaaacctcgggcatcggcgtcaag
ccagtgtcgcgcgaaggcaccgagcgcctggtgcgcaaggcgatccagtacgcgatcgac
aacgacaagccatccgtgaccatcgtccacaaaggcaacatcatgaagtacaccgaaggt
ggcttccgtgactgggcctacgcgctggcacagaaagaattcggcgccgagctgatcgac
ggcggcccatggtgcaaattcaagaatccgaagaccggtcgcgagatcatcgtcaaggat
tcgatcgccgacgccttcctgcagcagatcctgctgcgtccagcagagtacagcgtgatc
gccaccctgaacctgaacggcgactacatctccgacgcgctggcggcacaagtaggcggc
atcggcatcgcgccgggcgccaacctgtccgactccgtggcgatgttcgaagccacccac
ggcaccgcaccgaaatacgccggcaaggactacgtgaacccaggttcgctgatcctgtcc
gctgaaatgatgctgcgccacatgggctggaccgaagcggccgacctgatcatctcctcc
atggagaaggccatcacctcgaagaaagtcacctacgacttcgcccgcctgatggaaggc
gcgacccaggtgtcgtgctccggcttcggcgacgtgatgatcgagcagatgtaa

DBGET integrated database retrieval system