KEGG   Microvirga ossetica: BB934_16235Help
Entry
BB934_16235       CDS       T05139                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
moc  Microvirga ossetica
Brite
KEGG Orthology (KO) [BR:moc00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BB934_16235
Enzymes [BR:moc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BB934_16235
DNA repair and recombination proteins [BR:moc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BB934_16235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ANY79583
UniProt: A0A1B2EHX1
LinkDB All DBs
Position
complement(3462703..3465288)
Genome map
AA seq 861 aa AA seqDB search
MARAKKPATSGKTASRRSAADPARRSAPLKAYAAKRNFAATPEPKGKTVRRQADRFCIQR
HDARRLHFDLRLELDGVLKSWAVTRGPSLVSGEKRLAVHTEDHPIEYLTFEGGIPRGEYG
GGTMIVWDTGTWTPIGDPHRGYAKGHLEFELAGQRLNGRWHLVRMRAKPRESKEQWLLIK
SDDEYAKPKDEPEIVSVELTSILSGKTNGDLAASDEIRSDHAERAKAAGTKPRPVPELAR
MPKARKGLLRTFIEPSLATLVDEAPHGDEWIHEIKFDGYRLQARIDGKNVKLLTRKGLDW
TAKFKPVAAALRDLKLGSALLDGELVVEDKTGLSSFASLQADLKSGRTDRMVFNAFDLLY
LDGYDLTKLPLIERKTFLATLLEDAPAGGILRYSSHLEGDGETMIRHACRLGLEGIVSKH
RDRPYLASRGMHWQKTKCTQRQEFVIAGYVPSSVSPKAIGSLVLGVYEDKRLVHVGRVGT
GFSATLARDLWTDLERLKRPASPFSAALSRDAARGVRWVKPELVAEVEFRGWTTDGILRH
ASYKGLREDKDPSEIVRETAKSALSRANAPALSSFNLTHPDRMLWPDTGLTKQGLADYYA
DIAEWILPHVANRPLSLVRCPSGIEGSCFFQKHAWNGMSKAVQHRAIDGEDTLFIDDLEG
LIALVQSGVLEIHAWGSSMENPETPDRIVMDLDPAEDVPWTALIDAALEVRERLGNAGLE
SFVKTTGGKGLHLVAPLRPKAGWDEVKSFAQSLAETMAGDSPDRYVATMSKRARAGKIFV
DYLRNGRGATAVAPYSTRARSGAPVSTPLAWSELSASMRPDHFTVANLPTRLAHLKSDPW
ADLPELDQGLPQRKGRSRKRG
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgcaaagaagcctgcaacctcgggtaaaaccgcctcgcgacgcagtgccgcc
gatcctgcacggcgctccgctccgctcaaggcatacgcggcgaagcgaaacttcgcggca
actcctgaaccgaaaggcaagaccgttcggcggcaggccgaccgtttctgcattcagagg
cacgatgcgcgccgcctgcatttcgacctacggctcgagctcgacggggtcttgaaaagc
tgggccgtgacgagaggcccgagccttgtttcaggcgagaagcgtctcgcagtccatacg
gaagaccatcccatcgagtatctgaccttcgaaggcggcatcccgcgcggcgagtatggc
ggcggaacgatgatcgtctgggacacgggaacctggacgccgatcggcgatccccatcga
ggatatgcgaaggggcatctcgaattcgaattggcagggcagcggctcaacgggcggtgg
cacctcgtgcgcatgcgtgcgaagcctcgcgagagcaaggagcaatggctcctgatcaag
agcgacgatgaatatgcgaagcccaaagatgaaccggagatcgtatccgtcgaactgacg
tctatcctgtcaggtaagacaaacggcgatctggccgcgtcggatgaaatcaggtcggat
cacgcggagcgcgcgaaggctgcaggcacgaagccgaggcccgttcccgaactggctcgc
atgccgaaggcgcgcaaaggactgctgcgaaccttcatcgagcccagtctcgcaaccctg
gtcgatgaggctccccatggggacgaatggatccacgagatcaagttcgacggctatcgt
ctgcaggcgcggatcgacggcaagaacgtcaagctcctcacccgcaaaggcctcgactgg
acggcgaaattcaagcccgttgccgccgccctccgggacctgaagctcggctcggctctc
ctcgatggcgagctcgtcgtcgaggacaagaccgggctctcgagcttcgcgtccctgcag
gccgacctgaaatcgggtcggaccgaccggatggtcttcaatgcattcgaccttctctat
ctcgacggatacgatctgacgaaattgcctctcatcgagcggaaaacctttctggcgacg
ctgctggaggatgcgccggcaggcgggatcctgcgctacagctcgcatctcgagggcgac
ggcgaaaccatgatccgccatgcctgccgcctgggcctggaaggcatcgtctcgaaacat
cgcgacaggccctatctcgccagtcgcggcatgcattggcagaaaaccaaatgcacgcag
cgccaggaattcgtcatcgcgggttatgtgccctcgagtgtttcgccgaaggcgatcggt
tcgctcgttctcggcgtctacgaggacaagcgtctcgtccatgtagggcgcgtcgggacc
ggcttctccgcaacgctcgcgcgcgacctctggaccgacctcgaacggttgaagcggccc
gcctccccgttctcggcagcgctgtcgcgggacgcggctcgcggcgttcgctgggtgaag
cccgaactggtggccgaggtcgagtttcgaggatggaccactgacggcatcctccgtcac
gcctcctataaaggcctcagggaagacaaggacccgagcgagatcgttcgggagaccgcg
aaatccgcgctgtctcgcgcgaacgccccggcactatcgtccttcaatctcacccacccg
gaccggatgctctggccggatacggggctcaccaagcagggactggccgattactacgcg
gatatcgccgagtggatcctgccgcatgtcgcgaaccgccccctctccctggtccgctgc
ccatccggaatcgaaggttcctgctttttccagaagcatgcctggaacggcatgagcaag
gccgtgcagcatcgggccatagacggcgaggacaccttgttcatcgacgatctggagggc
ctgatcgcactggtgcaatcgggtgtcctcgagattcatgcctggggctcgtccatggaa
aatccggagacaccggatcggatcgtcatggacctcgatccggcggaggacgtgccttgg
accgctctgatcgacgctgcactggaggtaagggagcggcttggcaatgcgggcctggag
agcttcgtcaagacgaccggcggcaagggattgcatcttgtcgctccgctccggcccaag
gccggctgggacgaggtgaagtccttcgcgcaatcccttgctgaaaccatggccggcgac
agtccggaccgatacgtcgccaccatgtccaagcgtgcccgtgcgggaaagatcttcgtc
gactatctgcgcaacgggcgtggcgcgacagccgtcgcgccttactccacacgcgcccgc
tcaggtgctccggtgtcgacaccgctggcctggagcgagctctcggcgtccatgcgtccg
gaccattttaccgtcgcgaacctgccgacccgtctcgcccatctgaaaagcgatccctgg
gccgatcttccggagctggatcagggattaccgcaacggaagggacgttctcgaaagcgc
ggttag

DBGET integrated database retrieval system