KEGG   Methylobacterium oryzae: MOC_0263Help
Entry
MOC_0263          CDS       T03299                                 

Definition
(GenBank) AMP-dependent synthetase
Organism
mor  Methylobacterium oryzae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
257907..260849
Genome map
AA seq 980 aa AA seqDB search
MKIKTRRRDTAYLNCGCGLEPGHFAGIPESFVENVARLPSERFDPVAQPTGAAVLDMVRS
LLLELHPERGATIAVDLDSDLEREFGLDSLGRAELILRLSRSFRVSLPERLIGEAATPAA
LLAAIQAAGAAREPSAASPPPAALPTAAEPHRATTWADVLDFHVRNHPDRPHLRLQQEDG
TETVLTYAALDRRSRHVAAGLLKLDLAFGDRVALMLPTGPDFFPAFLGTILAGGVPVPLY
PPFRRAQIQDHLQRQVGILANAAPQILITDAAIKPFAWLLRDGVESLRVLTTTADLVTED
ALAAAVPATGADLALIQYTSGSTGDPKGVMLTHANLLANVRAMGEAVAASSADVVVSWLP
LYHDMGLIGCWLGSLYYGAPAAILSPLAFLADPGRWLRTIHRQRGTISAAPNFAYELCLK
TLRDEDLAGLDLSSLRVLTNGAEPVSPDTLARFTERFAAFGLRPSAVTPVYGLAECAVGL
TFPPLGRGPRIDWIDRATLSRSGEALPAEPGAPGAVAFAACGHPLRGHQIRIVDEAGREV
PERREGRLKFNGPSATTGYFRRPEITRALFDGAWLESGDLAYLASGDVFVTGRTKDIIIR
AGRKIHPHELEEVAGAVDGVRKGCVAAFASPDPRTGTERLILAAETRLTDAAALEELRRT
LAREAMGVIEQPPDVIVLCPPRTLPKTSSGKIRRAATRSLYAAGELGRPEAALRTQLVRL
AVAGAAARLRRIGRLWSEAAYAASWWGVLVVIGAILWPLVLVLPKRAWRFGALRTGLRLF
FWVTRTPLTVSGEPVSRGAVIVANHASYLDGAVLAAVLPGAPVFLAKQELARQRIAGPFL
RRLGTAFVHRGTVAGIADAAAIVGRIRDGEQVVAFPEGTFTRTPGLLGFHPGAFLDACRA
GAPIVPVAITGTRSALRADQWFPRRSGIHVHIGAPIAPDGEDFHAAIRLRNRTRAAILAG
CNEPDLSREAVPPPVEPAPE
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaagacgcggcggcgggacacggcttatctgaattgcggatgcggcttggag
cccggtcattttgccggcatcccggagtccttcgtggagaacgtcgcgcgcctgccgagc
gagcggttcgatccggtcgcgcagcccaccggagccgctgtcctggacatggtccggtcg
ctcctgctcgaactgcacccggagcggggggcgacgatcgcggtcgacctcgacagcgat
ctcgaacgggagttcggcctcgacagcctggggcgcgcggagctgatcctgaggctgtcg
cgcagcttccgggtgtcgctgccggagaggctgatcggcgaggcagcgacgccggccgcg
ttgctggccgcgatccaggctgcgggcgccgcgcgcgagccctcggcggcgtctccgcca
ccagccgcgctgccgacggcggccgagccgcaccgggccaccacgtgggcggacgtgctc
gatttccacgtccgcaatcacccggaccgcccccatcttcgattgcaacaggaggacggg
accgagaccgttctgacctacgcggcgctcgaccggcgttcgcgtcatgtcgcggccggc
ctcctgaagctcgatctcgccttcggcgaccgggtcgccctcatgctgcccaccgggccc
gacttcttcccggccttcctcggcacgatcctggcgggtggggtcccggtcccgctctac
ccgccgttccggcgcgcccagatccaggatcacctgcagcgtcaagtcggtatcctggcg
aacgccgcgccgcagatcctgatcaccgatgcggcgatcaaacccttcgcctggctgctg
cgcgacggcgtcgagagtttgcgggtcctgacgaccaccgcggatctcgtgacggaagac
gctctggcggcggccgtcccggccacgggggcggaccttgcgctgatccaatacacctcc
ggcagcacaggcgatccgaagggcgtgatgctgacccacgccaacctgctcgccaatgtc
cgcgccatgggcgaagcggtggcggcctcgtcggcggacgttgtcgtgagctggctccct
ctctaccacgatatgggattgatcggctgctggctgggcagcctctattacggtgcgccg
gcggcaatcctttcacccctggccttcctggccgatccggggcgctggctcaggacaatc
catcgccagcgcggcacgatctcggccgccccgaacttcgcctacgagctgtgtctcaag
accctgcgggacgaggatctcgcggggctcgatctcagctcgctgcgcgtcctgaccaac
ggggccgaaccggtcagcccggacacgctggcccggttcactgagcgcttcgcggccttc
ggcctccggccgtcggccgtcacacccgtctacgggctcgccgaatgcgcggtcggcctc
acctttccgcccctcggccggggcccgcgcatcgactggatcgaccgcgcaacgctgtcg
cggagcggcgaggccctgccggccgagcctggcgctccgggggccgtcgccttcgccgcc
tgcgggcatccgttgcgcggccatcagatccggatcgtggacgaggccgggcgcgaggtg
ccggagcgccgggaggggcggctgaagttcaacggtccctccgcgacgaccggctacttc
cggcgtccggagatcacgcgcgccctgttcgacggagcttggctcgagagcggcgacctc
gcctatttggcgagcggcgacgtcttcgtgacggggcgtaccaaggacatcatcatccgg
gccggtcggaagatccatccgcacgagctggaagaggtggcgggtgcggtcgacggcgtc
cgaaagggctgtgtcgcggccttcgcgagccccgacccgagaaccgggacggagcggctg
atcctcgccgccgagacgcgcctcaccgacgccgcggcccttgaggagctgcgccgcacc
ctggcccgggaagcgatgggcgtgatcgagcagccgcccgacgtgatcgtcctgtgtccg
ccccgcacattgccgaagacgtcgagcgggaagatccgtcgcgcggcgacgcggtcgctc
tacgcggcaggcgaactcggccggccggaagccgccctgcggacgcagctggtccggctc
gccgtcgcgggggccgcggcgcggctgcgccgtatcgggcggctctggtcggaggcagcc
tacgcggcgtcctggtggggagtcctcgtcgtcatcggtgccatcctatggccgctggtg
ctcgtcctgccgaagcgcgcttggcgcttcggcgccctccggacgggcctgcggctcttc
ttctgggtcacgcggacgccgttgaccgtatcgggcgagcccgtcagccgcggcgccgtc
atcgtcgccaaccatgcgagctatcttgacggcgccgtgctggcggccgtgctgcccggg
gcgccggtcttcctcgccaagcaggagctggcccgtcagcgcatcgccgggccgttcctg
cggcggctgggaaccgccttcgtccaccggggtaccgtggcgggtatcgccgacgcggcg
gcgatcgtcgggcgcattcgcgatggcgagcaggtggtcgcgttcccggagggcaccttt
acccggaccccgggcctcctcggcttccatcccggtgcgtttctagatgcctgccgcgcg
ggtgccccgatcgtgccggtcgcgatcacgggcacgcggtcggcgctgcgggccgatcag
tggttcccccggcggagcgggatccacgtccatatcggagcgccgatcgccccggacggc
gaggatttccacgcggcgatccgcctgcgcaatcggacgcgcgcggcgattctcgccggc
tgcaacgagccggacctctcccgggaagcggtgccgccgcccgtcgagccggctccggaa
tga

DBGET integrated database retrieval system