KEGG   Methylobacterium oryzae: MOC_1982Help
Entry
MOC_1982          CDS       T03299                                 

Definition
(GenBank) Trehalose synthase
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mor  Methylobacterium oryzae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MOC_1982
Enzymes [BR:mor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MOC_1982
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     MOC_1982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2022530..2025808)
Genome map
AA seq 1092 aa AA seqDB search
MIDRSDPQWYRDAIIYQIHVKSFFDSNNDGIGDFEGLTQRLDYVRDLGVTAIWLMPFYPS
PLRDDGYDIADYRDINPSYGTMEAFKAFVEAAHARGLRVITELVINHTSDQHPWFQAARE
APPGSPERNFYVWSDTDEPYRDTRIIFLDTEASNWTWDPVAKQYFWHRFYSHQPDLNFDN
PAVLEAVIEVMRYWLDMGVDGLRLDAIPYLIERDGTNCENLAETHDVIKKIRAALDASYP
DRMLLAEANQWPEETAQYFGDGDECHMAFHFPLMPRMYMAIAREDRHPITDIMRQTPEIP
EGCQWAIFLRNHDELTLEMVTAEERDYLWSFYAAERRARINLGIRRRLAPLLENDRRKIE
LMKSLVLSMPGTPVLYYGDEIGMGDNIYLGDRDGVRTPMQWSPDRNGGFSRANPQKLFLP
AIQDPIYGFDAINVEAQTQAQTSLLNWTRRMIAIRNNSVALGRGTIQFLYPSNRKVLAWI
REHEDERILCVANLSRAPQAVQLDLSELRTAVPIELTGGTEFPPIGDLPYLLTLPSYGFY
WFSLSAARSGVVGPQQEPPELFTLVLTGGIETLMSGRERVAFERTVVPPFLTSRRWFGAK
GSRIKATKVVDCAALKDVDGSARFLLPRLQVQLANGESHEYFMPVGVEEGREDEALMPFA
VARVRRGPRTGLLYGAAGSNDFAACLIDDMRQGRVIPTESGRLVFAVTSAFDPEVTVDVA
DIRRLSAEQSNTSIAVGSKMMLKLLRRLQPGLHPEIEVGRFLTEQAGFSNTPALLGTLEH
VAEDGTRTALAILQKFVVNQGDAWTLMLEGLRRDFETVVLTPESEAASPEEAFQAHRPWA
DLLGRRTAELHAALAIETDDPAFAAEPFTGDDLAVLARDARHQAERAFRALKGLADRGLD
AGKPACAELGQRRGEVEALIAALTAEPVRGAHKTRIHGDYHLGQVLVAENDLIIVDFEGE
PSRPADERRAKSMPLRDVAGLMRSFAYGAETVIREITARFADSEGRARDAATAWRGMIEA
AFLAGYESAVEGSRAAVTDLGSRARLLRLCLLTKALYEVDYEANNRPDWIEIPARGVLTI
LDTDGHEPGALE
NT seq 3279 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcgcagcgacccgcaatggtaccgtgacgccatcatctaccagatccacgtc
aagtcgttcttcgactcgaacaacgacgggatcggcgacttcgagggcctgacccagcgc
ctcgactacgtccgcgatctcggcgtcacggcgatctggctgatgccgttctatccctcg
ccgctccgcgacgacggctacgacatcgccgattaccgggacatcaacccgtcctacggg
accatggaggccttcaaggccttcgtggaggcggcgcacgcccggggcctgcgggtcatc
accgaactcgtgatcaaccacacgagcgaccagcacccctggttccaggccgcccgcgag
gcgccccccggctcgccggagcgcaacttctacgtctggtcggacaccgacgagccgtac
cgggacacgcggatcatcttcctcgataccgaggcgtccaactggacctgggacccggtg
gccaagcagtatttctggcaccggttctacagccaccagccggacctgaacttcgacaac
ccggcggtgctcgaggccgtcatcgaggtgatgcgctactggctcgacatgggcgtcgac
ggcctgcgcctcgatgcgatcccctacctgatcgagcgcgacggcacgaactgcgagaac
ctcgccgagacccacgacgtcatcaagaagatccgcgccgccctcgatgccagctacccc
gaccggatgctgctggccgaggccaaccagtggccggaggagaccgcccagtatttcggc
gacggcgacgaatgccacatggcgttccacttcccgctgatgccgcggatgtacatggcg
atcgcccgggaggaccggcacccgatcaccgacatcatgcgccagaccccggagattccg
gagggctgccaatgggcgatcttcctgcgcaaccacgacgagctgacgctcgaaatggtc
accgccgaggagcgtgactacctctggtcgttctacgccgcagagcgccgcgcccggatc
aatctcggcatccgccgccgcctcgcgccgctcctcgagaacgaccggcgcaagatcgaa
ttgatgaagtccctcgtcctgtcgatgcccggcacgccggtgctctactacggcgacgag
atcggcatgggcgacaacatctatctgggcgaccgcgacggcgtgcgcacgcccatgcaa
tggtccccggaccgcaacggcggcttctcccgggcgaacccccagaagttgttcctgccg
gcgatccaggacccgatctacggcttcgacgccatcaacgtcgaggcgcagacccaggcg
cagacgagcctgctgaactggacgcggcgcatgatcgcgatccgcaacaacagcgtcgcc
ctcgggcgcggcacgatccagttcctctatcccagcaaccggaaggtcctggcctggatc
cgcgagcacgaggacgagcggatcctgtgcgtggcgaacctgtcgcgggcgccccaggcg
gtgcagctcgacctgtcggaactgcgcaccgcggtgccgatcgagctcaccggcggcacc
gagttcccgccgatcggcgatctgccctacctgctgaccctgccgtcctacggtttctac
tggttcagcttgagcgccgcgcgctccggggtggtcggcccgcagcaggagccgccagag
ctgttcaccctggtgctcaccggcgggatcgagaccctgatgagcgggcgtgagcgcgtc
gcctttgagcgcacggtggtgccgccgttcctgacgagccggcgctggttcggcgccaag
ggctcgcggatcaaggccacgaaggtggtcgactgcgccgccctgaaggacgtcgacggg
agcgcgcgcttcctgctgccgcggctgcaggtgcagctcgccaacggcgagagccatgag
tacttcatgccggtcggcgtcgaggagggccgcgaggacgaggcgctgatgcccttcgcg
gtggcgcgggtgcgccgcggcccgcggaccgggctgctctacggcgcggccggctccaac
gacttcgccgcctgcctcatcgacgacatgcgccagggccgtgtgatccccacggagagc
ggccgcctcgtcttcgccgtcacctcggccttcgacccggaggtcacggtcgacgtggcc
gatatccgccggctgtcggcggagcagagcaacacctcgatcgccgtcggctcgaagatg
atgctcaagctgctgcgccgcctgcagccggggctgcatcccgagatcgaggtcgggcgc
ttcctcaccgagcaggcgggtttctccaatacccccgccctgctcggcacgctggagcac
gtcgccgaggacgggacccggacggccctcgcgatccttcagaaattcgtcgtgaaccag
ggcgatgcctggaccctgatgctggagggcctgcgccgggacttcgagaccgtcgtgctc
acccccgagagcgaggccgccagccccgaggaggcgttccaggcccaccggccctgggcg
gatctgctcgggcggcgcaccgccgagctgcacgcggcgctggcgatcgagaccgacgat
ccggccttcgcggccgagccgttcaccggggacgatctcgcggtgctggcgcgcgacgcc
cgccaccaggcggagcgtgccttccgggcgctcaagggcctggccgaccgggggctcgat
gccggcaagccggcctgcgcggaactcggccagcgccggggcgaggtcgaggccctgatc
gccgcgctcaccgccgagccggtccggggcgcccacaagacccgcatccacggtgactac
cacctgggacaggtgctggtcgccgagaacgacctgatcatcgtcgacttcgagggcgag
ccctcgcgtccggccgacgagcgccgggccaagtcgatgcccctgcgggacgtcgccggg
ctgatgcgctccttcgcgtacggcgccgagacggtgatccgggagatcaccgcccggttc
gccgattccgaggggcgggcgcgggacgccgccacggcgtggcgcggcatgatcgaggcg
gcgttcctcgccggctacgagtccgcggtggagggctcgcgcgccgccgtgaccgacctg
ggaagccgggcgcggctgctgcgcctctgcctgctgaccaaggccctgtacgaggtcgat
tacgaggccaacaaccggccggactggatcgaaatccccgcccgtggggttctgaccatt
ctggacacggacggacacgagcccggagcattggaatga

DBGET integrated database retrieval system