KEGG   Moraxella osloensis: AXE82_03975Help
Entry
AXE82_03975       CDS       T04294                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
mos  Moraxella osloensis
Pathway
mos00020  Citrate cycle (TCA cycle)
mos00270  Cysteine and methionine metabolism
mos00620  Pyruvate metabolism
mos00630  Glyoxylate and dicarboxylate metabolism
mos00680  Methane metabolism
mos01100  Metabolic pathways
mos01110  Biosynthesis of secondary metabolites
mos01120  Microbial metabolism in diverse environments
mos01130  Biosynthesis of antibiotics
mos01200  Carbon metabolism
Module
mos_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mos_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mos_M00012  Glyoxylate cycle
mos_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mos00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AXE82_03975
   00620 Pyruvate metabolism
    AXE82_03975
   00630 Glyoxylate and dicarboxylate metabolism
    AXE82_03975
  Energy metabolism
   00680 Methane metabolism
    AXE82_03975
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AXE82_03975
Enzymes [BR:mos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     AXE82_03975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: AME01025
UniProt: A0A0X8K5S9
LinkDB All DBs
Position
complement(916060..917046)
Genome map
AA seq 328 aa AA seqDB search
MKQPVRVAVTGAAGQISYSLLFRIASGDMLGKDQPVILQLLEITPALEALKGVVMELEDC
AFPLLAGVVQTDDANVAFKDADYALLVGARPRGPGMERKDLLEANAAIFSAQGKALNDNA
SRTVKVLVVGNPANTNALIAQRNAPDLDPRNFTAMTRLDHNRGIAQLAEETETTVNDIKK
MIIWGNHSSTQYPDLTFTTVKGQPALEQVQRDWYEGTYIPNVQQRGAAIIKARGASSAAS
AANAAIAHIRSWALGTDENDWVSMGVYSNGEYGIQKGLIYSFPCTCQNGDWKIVEGLDVS
SAFSQEKMKATETELAEERDAVSHLLPN
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcctgttcgtgttgcggtgactggtgctgctggtcaaatcagttattcatta
ttatttcgtatcgcatcgggtgatatgttgggtaaagaccaacctgtcattttacaatta
ttagaaatcacgccagctttagaagccttaaaaggtgtggtaatggaacttgaagattgt
gcattcccattgctagcgggcgtcgtacaaactgacgacgctaatgttgcgttcaaagat
gcggactatgccctactggtaggtgcccgtcctcgtggtcctggcatggagcgtaaagat
ttgctcgaagccaacgccgccatcttctctgcacaaggtaaagcgttaaatgacaacgct
agccgtactgtcaaggtattggttgtgggtaaccccgccaacaccaacgccttaatcgca
cagcgcaatgccccagacctagacccacgtaactttaccgcgatgacgcgtcttgaccac
aaccgtggtatagcgcaattggcagaagaaactgaaactaccgtgaatgacatcaaaaaa
atgatcatttggggtaaccactcttcaacccagtacccagatttgaccttcacgactgta
aaaggtcaacctgccctagagcaagtacaacgtgactggtacgaaggtacttatatccct
aacgtacaacaacgtggtgctgccatcattaaagcacgtggtgcctcatcagcggcatct
gcggcaaacgctgccattgcgcacattcgttcatgggcactaggcactgacgagaatgat
tgggtatctatgggtgtttactcaaatggtgagtacggtatccaaaaaggtcttatctat
tcattcccatgtacttgccaaaatggcgattggaaaattgttgaagggctagatgtttca
tcggctttctcacaagaaaaaatgaaagccaccgaaactgagctcgctgaagagcgtgat
gcggtaagccacttattacctaactaa

DBGET integrated database retrieval system