KEGG   Candidatus Methylomirabilis oxyfera: DAMO_1068Help
Entry
DAMO_1068         CDS       T02155                                 

Definition
(GenBank) protein of unknown function
  KO
K16150  
glycogen synthase [EC:2.4.1.11]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DAMO_1068
Enzymes [BR:mox01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     DAMO_1068
Glycosyltransferases [BR:mox01003]
 Polysaccharide
  Storage polysaccharide
   DAMO_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(900861..902162)
Genome map
AA seq 433 aa AA seqDB search
MRIMMVTGSLGGPSKPCGGAELHVLSLMQALSKRRHGIALLTGRSPNVPIQPPGVEAIFS
TKTAFPILLTKLFQFDPVVYLSTLRIFRAWPPDIVHLHSFFNLSFAPIAAANRLRIPVLA
TLHTYWPVCLRQQLCYNEDGSCRQRYASEICAPCLARGLRDKMGVRLPVPFVNLVLRRAW
RARRHLLQGVARFIAPSSTLARSLRESGFPTDRIVVIPHGLPQNNFALRPREPRFGQPGP
HLLYVGRLVAGKGVQYLLEAIPQIRRAFPDLIITIAGDGPYRPALEQLCTSLGLMRITRF
IGFRPRSHLAKLYAETDVIVIPSLSEVFSYVVLEAAAAGTPIVATTVGGIPEIVANGAVL
VPPGDAAALAGGILAVLSDPTAAAARARLSQNRSLECFKFETMVDRAEAVYAELLNDGCF
PIAPYPAVLAQPH
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattatgatggttacaggtagcctcggcggacccagcaagccatgcggaggggcg
gagcttcacgttctgagtttgatgcaggcactcagcaagcgcaggcatgggattgctctc
ctgaccgggcgatctccaaacgtgccaatccaacctccaggggtcgaggcaatcttctca
acgaagactgccttcccgattttgctgacgaaacttttccaatttgatccagtcgtatat
ctttcaacccttcgcattttccgcgcttggcctcctgatatcgtccatttgcactccttt
ttcaatctttcatttgcaccgattgccgcggcgaaccgcctccggatccctgtactcgcg
acgctgcatacctattggccggtctgcctccgccaacagctctgttacaatgaggacggg
agttgtcgccaacgctacgcatcggagatctgtgcgccttgtctggcgcgaggactcagg
gacaagatgggggttcgccttcctgtaccgtttgtgaacctcgttctccgtagagcatgg
agagcacgtcggcatcttctccagggggttgcccggtttatcgcccccagcagcacgctc
gcgcggagcctgagagagtccgggtttcccaccgatcgaatcgtagttatcccgcatggt
cttccacaaaacaacttcgctcttcgtccacgagaacctcggtttggacaacctggtcct
catctgctgtatgtgggtcgactggtagcgggcaagggtgtgcagtatctactcgaagcg
atccctcagattcgtcgagcgttcccggacctgatcatcacgatagcgggcgatggtccc
tatcggcccgcactcgagcaattgtgtacctccctggggctaatgaggataactcggttc
atcggctttcgaccgcggtctcacctggcgaaattgtacgctgaaaccgatgtcatcgtt
atcccatccttatccgaggtattttcgtatgtagtgctggaggcagcggcagccgggact
ccgatcgtagcgaccaccgtgggcggcatacctgagattgttgcgaacggcgcagtcctg
gtcccgccgggagacgctgccgcactcgccggcggcatccttgcggtactgtcggatcct
acagcggctgccgcccgagccagactgagccaaaaccggtccctggagtgcttcaagttc
gaaacgatggtagatcgcgcagaggcggtatacgccgagctgcttaatgacgggtgcttc
cctatagctccttacccggccgttctcgcacagccgcattga

DBGET integrated database retrieval system