KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP_4257Help
Entry
MAP_4257          CDS       T00156                                 

Gene name
gadB
Definition
(GenBank) GadB
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
mpa00250  Alanine, aspartate and glutamate metabolism
mpa00410  beta-Alanine metabolism
mpa00430  Taurine and hypotaurine metabolism
mpa00650  Butanoate metabolism
mpa01100  Metabolic pathways
mpa01110  Biosynthesis of secondary metabolites
mpa01120  Microbial metabolism in diverse environments
mpa02024  Quorum sensing
Module
mpa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MAP_4257 (gadB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAP_4257 (gadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAP_4257 (gadB)
   00430 Taurine and hypotaurine metabolism
    MAP_4257 (gadB)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    MAP_4257 (gadB)
Enzymes [BR:mpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MAP_4257 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AAS06807
UniProt: Q73S19
LinkDB All DBs
Position
4726387..4727778
Genome map
AA seq 463 aa AA seqDB search
MPQHPSLPAHAIAPAYTGRLFTAPVPALRMPDESMDPDAAYRFIHDELMLDGSSRLNLAT
FVTTWMDPEAGRLMAETFDKNMIDKDEYPATAAIEQRCVCMVADLFHAEGLNDADPYSAC
GVSTIGSSEAVMLGGLAMKWRWRAKTKDWKKRTPNLVMGSNVQVVWEKFCRYFDVEPRYL
PMEEGRYVITPEQVVDAVDEDTIGVVAILGTTYTGELEPVADICGALDKLALKPASAGGV
DVPVHVDAASGGFVVPFLHPELKWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRSKEYLP
DELVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYTKVMQTLSGTARWLGEQ
LRVSEHCELISDGSAIPVVAFRLAKNRGYTEFDVSHELRTYGWQVPAYTMPDNATDVSVL
RIVVREGLSADLARALHDDAVSALTSLDKVKPGGHYDAQHFAH
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgccccaacatccttcgctgcccgcgcatgccatcgccccggcctacaccggccggctg
ttcaccgcgccggtgcccgctctgcggatgcccgacgaatcgatggatcccgacgccgcc
taccggttcatccacgacgagctgatgctcgacggcagctcccggctgaacctggccacc
ttcgtcaccacctggatggaccccgaggccgggcggttgatggccgagacattcgacaag
aacatgatcgacaaggacgaatacccggccaccgcggccatcgagcagcgctgcgtgtgc
atggtcgccgacctgttccacgccgaaggtctgaacgacgccgacccgtacagcgcctgc
ggggtgtccaccatcgggtccagcgaggcggtgatgttgggcgggctggcgatgaagtgg
cggtggcgcgccaagaccaaggactggaagaagcgcaccccgaacctggtgatgggctcc
aacgtccaggtggtctgggagaagttctgccgctacttcgacgtcgagccccgctacctg
ccgatggaggagggccgctacgtcatcacccccgaacaggtcgtcgacgccgtcgacgag
gacaccatcggcgtggtggccatcctgggcaccacctacaccggcgagctggaaccggtc
gccgacatctgcggcgcgctggacaagctggccctcaaaccagcatcagccggcggcgtg
gacgtcccggtgcacgtcgacgccgccagcggcgggttcgtggtgccgttcctgcacccc
gagctcaagtgggacttccggctgccccgggtggtgtcgatcaacgtcagcgggcacaag
tacgggctgacctatcccggcgtcggcttcgtggtgtggcgcagcaaggaatacctgccc
gacgagctggtgttccgggtcaactacctgggcggcgacatgccgaccttcacgctgaac
ttctcccgccccggcaaccaggtggtcggccagtactacaacttcctgcggctgggccgc
gagggctacaccaaggtgatgcagacgctgtccggcacggcgcgctggctgggcgagcag
ctgcgggtcagcgagcactgcgagctgatctcggacggctcggcgatcccggtggtcgcc
ttccggctggccaagaaccgcggctacaccgagttcgacgtctcccacgagctgcgcacc
tacggctggcaggtgcccgcctacaccatgcccgacaacgccaccgacgtctcggtgctg
cgcatcgtggtgcgtgaggggctgtcggccgacctggcccgggcgctgcacgacgacgcc
gtctcggcgctgacctcgctggacaaggtcaagccgggcggccactacgacgcccagcac
ttcgcgcactga

DBGET integrated database retrieval system