KEGG   Marinomonas posidonica: Mar181_2762Help
Entry
Mar181_2762       CDS       T01508                                 

Definition
pyruvate kinase (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
mpc  Marinomonas posidonica
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Overview; Carbon metabolism [PATH:mpc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mpc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mpc00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mpc00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mpc00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3062449..3063894
Genome map
AA seq 481 aa AA seqDB search
MTRRTKIVATLGPASSSPEMIEKLILAGANVFRLNFSHGQPEDHINRADVVRAMAEKNNR
HVAILGDLQGPKIRIARFKNTKVELQDGATFILDVGFDKNAGDETRVGIDYPQLAEDSNP
GNILLLDDGRVVLEVLEVKGTEVITKVIVGGPLSNNKGINRQGGGLSAAALTEKDKEDIK
TAAALKADYLAVSFPRSADDLHEARELALAAGLKAGIVSKVERAEAVADNETLDSIILAS
DAVMVARGDLGVEIGDAELIGVQKHMIKRCRQLNRPVITATQMMETMITSAMPTRAEVFD
VANAVLDGTDAVMLSAETAAGDYPEEVIQTMNRVCLGAEKQPAINRSKHRIDVTFTSIDE
TIALSAMYAANHLEGVKAIISLTESGTTPLLMSRISSGLPIFALSPNQATLNKAALYRGV
TPVSFSSQEYNVDNIISGLVDHVKSLGYIADGDLVIVTKGDHLVSYGTTNAMKIVKVGDI
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtagaactaaaatcgttgccactttaggccctgcttcaagctctcctgaaatg
atcgaaaagttaatcttggcaggcgcgaacgtcttccgtttaaacttctcacatggtcaa
ccagaagatcacatcaatcgtgctgacgtggttcgcgctatggcagagaaaaacaatcgc
catgttgcgatcttgggagacctacaaggccctaagattcgtatcgcacgattcaaaaac
accaaggtagaattacaagatggcgccacgtttattctggatgtgggctttgataaaaat
gccggtgatgaaacacgagttggcatcgactacccacaactggctgaagattcaaaccca
ggcaatatcctgttattagatgacggtcgagtggtactagaagtattagaagttaaaggc
acagaagtcattaccaaagtcattgttggcggcccattgtctaacaacaaaggcatcaac
cgccaaggcggtggtttgtctgccgcagcgctgacagaaaaagataaagaagacatcaaa
acagccgcggcactaaaagccgattaccttgctgtttctttccctcgcagtgccgatgac
cttcacgaagcccgtgaattggctctagcagcaggtttgaaagctggcatagtatcaaaa
gtagaacgcgctgaagccgttgctgataacgaaaccctagacagtatcattcttgcttcc
gacgccgttatggtggcacgtggcgacctaggtgtggaaattggtgatgccgagttgatt
ggtgtgcaaaaacacatgatcaagcgttgtcgccaactaaaccgccctgtgattacagcg
acacaaatgatggaaaccatgatcaccagcgccatgccaactcgtgctgaagtattcgat
gttgccaacgctgtactagatggcacagatgcggtcatgctgtcggctgaaaccgcggcg
ggcgattacccagaagaagttatccagacgatgaaccgtgtttgcttaggtgcagaaaaa
cagcctgcgattaaccgctctaagcaccgtattgatgttactttcactagcattgatgaa
accattgccttgtcagctatgtacgctgctaaccaccttgaaggcgtgaaagccatcatc
agcttaactgaatcaggcacaacaccactattgatgtctcgtatcagctcaggcttgccg
atttttgccctgtccccaaaccaggcaacattgaacaaagcggctctttatcgtggtgtg
acacctgtgtcattctcatcccaagaatacaatgtcgacaacatcatctctggtttagtc
gatcacgttaaatctctaggctacattgccgatggtgaccttgtgatcgtgacgaaaggc
gatcaccttgtcagctatggcacaaccaatgctatgaaaattgtcaaagtgggcgacatc
gtctaa

DBGET integrated database retrieval system