KEGG   Marinomonas posidonica: Mar181_2762Help
Entry
Mar181_2762       CDS       T01508                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00010  Glycolysis / Gluconeogenesis
mpc00230  Purine metabolism
mpc00620  Pyruvate metabolism
mpc01100  Metabolic pathways
mpc01110  Biosynthesis of secondary metabolites
mpc01120  Microbial metabolism in diverse environments
mpc01130  Biosynthesis of antibiotics
mpc01200  Carbon metabolism
mpc01230  Biosynthesis of amino acids
Module
mpc_M00002  Glycolysis, core module involving three-carbon compounds
mpc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mpc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mar181_2762
   00620 Pyruvate metabolism
    Mar181_2762
  Nucleotide metabolism
   00230 Purine metabolism
    Mar181_2762
Enzymes [BR:mpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Mar181_2762
Membrane trafficking [BR:mpc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Mar181_2762
Exosome [BR:mpc04147]
 Exosomal proteins
  Proteins found in most exosomes
   Mar181_2762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C
Motif
Other DBs
NCBI-ProteinID: AEF55793
JGI: Mar181_2762
UniProt: F6CZI1
LinkDB All DBs
Position
3062449..3063894
Genome map
AA seq 481 aa AA seqDB search
MTRRTKIVATLGPASSSPEMIEKLILAGANVFRLNFSHGQPEDHINRADVVRAMAEKNNR
HVAILGDLQGPKIRIARFKNTKVELQDGATFILDVGFDKNAGDETRVGIDYPQLAEDSNP
GNILLLDDGRVVLEVLEVKGTEVITKVIVGGPLSNNKGINRQGGGLSAAALTEKDKEDIK
TAAALKADYLAVSFPRSADDLHEARELALAAGLKAGIVSKVERAEAVADNETLDSIILAS
DAVMVARGDLGVEIGDAELIGVQKHMIKRCRQLNRPVITATQMMETMITSAMPTRAEVFD
VANAVLDGTDAVMLSAETAAGDYPEEVIQTMNRVCLGAEKQPAINRSKHRIDVTFTSIDE
TIALSAMYAANHLEGVKAIISLTESGTTPLLMSRISSGLPIFALSPNQATLNKAALYRGV
TPVSFSSQEYNVDNIISGLVDHVKSLGYIADGDLVIVTKGDHLVSYGTTNAMKIVKVGDI
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtagaactaaaatcgttgccactttaggccctgcttcaagctctcctgaaatg
atcgaaaagttaatcttggcaggcgcgaacgtcttccgtttaaacttctcacatggtcaa
ccagaagatcacatcaatcgtgctgacgtggttcgcgctatggcagagaaaaacaatcgc
catgttgcgatcttgggagacctacaaggccctaagattcgtatcgcacgattcaaaaac
accaaggtagaattacaagatggcgccacgtttattctggatgtgggctttgataaaaat
gccggtgatgaaacacgagttggcatcgactacccacaactggctgaagattcaaaccca
ggcaatatcctgttattagatgacggtcgagtggtactagaagtattagaagttaaaggc
acagaagtcattaccaaagtcattgttggcggcccattgtctaacaacaaaggcatcaac
cgccaaggcggtggtttgtctgccgcagcgctgacagaaaaagataaagaagacatcaaa
acagccgcggcactaaaagccgattaccttgctgtttctttccctcgcagtgccgatgac
cttcacgaagcccgtgaattggctctagcagcaggtttgaaagctggcatagtatcaaaa
gtagaacgcgctgaagccgttgctgataacgaaaccctagacagtatcattcttgcttcc
gacgccgttatggtggcacgtggcgacctaggtgtggaaattggtgatgccgagttgatt
ggtgtgcaaaaacacatgatcaagcgttgtcgccaactaaaccgccctgtgattacagcg
acacaaatgatggaaaccatgatcaccagcgccatgccaactcgtgctgaagtattcgat
gttgccaacgctgtactagatggcacagatgcggtcatgctgtcggctgaaaccgcggcg
ggcgattacccagaagaagttatccagacgatgaaccgtgtttgcttaggtgcagaaaaa
cagcctgcgattaaccgctctaagcaccgtattgatgttactttcactagcattgatgaa
accattgccttgtcagctatgtacgctgctaaccaccttgaaggcgtgaaagccatcatc
agcttaactgaatcaggcacaacaccactattgatgtctcgtatcagctcaggcttgccg
atttttgccctgtccccaaaccaggcaacattgaacaaagcggctctttatcgtggtgtg
acacctgtgtcattctcatcccaagaatacaatgtcgacaacatcatctctggtttagtc
gatcacgttaaatctctaggctacattgccgatggtgaccttgtgatcgtgacgaaaggc
gatcaccttgtcagctatggcacaaccaatgctatgaaaattgtcaaagtgggcgacatc
gtctaa

DBGET integrated database retrieval system