KEGG   Marinomonas posidonica: Mar181_2762Help
Entry
Mar181_2762       CDS       T01508                                 

Definition
(RefSeq) pyruvate kinase (EC:2.7.1.40)
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
mpc  Marinomonas posidonica
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mar181_2762
   01230 Biosynthesis of amino acids
    Mar181_2762
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mar181_2762
   00620 Pyruvate metabolism
    Mar181_2762
  Nucleotide metabolism
   00230 Purine metabolism
    Mar181_2762
Enzymes [BR:mpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Mar181_2762
Exosome [BR:mpc04147]
 Exosomal proteins
  Proteins found in most exosomes
   Mar181_2762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3062449..3063894
Genome map
AA seq 481 aa AA seqDB search
MTRRTKIVATLGPASSSPEMIEKLILAGANVFRLNFSHGQPEDHINRADVVRAMAEKNNR
HVAILGDLQGPKIRIARFKNTKVELQDGATFILDVGFDKNAGDETRVGIDYPQLAEDSNP
GNILLLDDGRVVLEVLEVKGTEVITKVIVGGPLSNNKGINRQGGGLSAAALTEKDKEDIK
TAAALKADYLAVSFPRSADDLHEARELALAAGLKAGIVSKVERAEAVADNETLDSIILAS
DAVMVARGDLGVEIGDAELIGVQKHMIKRCRQLNRPVITATQMMETMITSAMPTRAEVFD
VANAVLDGTDAVMLSAETAAGDYPEEVIQTMNRVCLGAEKQPAINRSKHRIDVTFTSIDE
TIALSAMYAANHLEGVKAIISLTESGTTPLLMSRISSGLPIFALSPNQATLNKAALYRGV
TPVSFSSQEYNVDNIISGLVDHVKSLGYIADGDLVIVTKGDHLVSYGTTNAMKIVKVGDI
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtagaactaaaatcgttgccactttaggccctgcttcaagctctcctgaaatg
atcgaaaagttaatcttggcaggcgcgaacgtcttccgtttaaacttctcacatggtcaa
ccagaagatcacatcaatcgtgctgacgtggttcgcgctatggcagagaaaaacaatcgc
catgttgcgatcttgggagacctacaaggccctaagattcgtatcgcacgattcaaaaac
accaaggtagaattacaagatggcgccacgtttattctggatgtgggctttgataaaaat
gccggtgatgaaacacgagttggcatcgactacccacaactggctgaagattcaaaccca
ggcaatatcctgttattagatgacggtcgagtggtactagaagtattagaagttaaaggc
acagaagtcattaccaaagtcattgttggcggcccattgtctaacaacaaaggcatcaac
cgccaaggcggtggtttgtctgccgcagcgctgacagaaaaagataaagaagacatcaaa
acagccgcggcactaaaagccgattaccttgctgtttctttccctcgcagtgccgatgac
cttcacgaagcccgtgaattggctctagcagcaggtttgaaagctggcatagtatcaaaa
gtagaacgcgctgaagccgttgctgataacgaaaccctagacagtatcattcttgcttcc
gacgccgttatggtggcacgtggcgacctaggtgtggaaattggtgatgccgagttgatt
ggtgtgcaaaaacacatgatcaagcgttgtcgccaactaaaccgccctgtgattacagcg
acacaaatgatggaaaccatgatcaccagcgccatgccaactcgtgctgaagtattcgat
gttgccaacgctgtactagatggcacagatgcggtcatgctgtcggctgaaaccgcggcg
ggcgattacccagaagaagttatccagacgatgaaccgtgtttgcttaggtgcagaaaaa
cagcctgcgattaaccgctctaagcaccgtattgatgttactttcactagcattgatgaa
accattgccttgtcagctatgtacgctgctaaccaccttgaaggcgtgaaagccatcatc
agcttaactgaatcaggcacaacaccactattgatgtctcgtatcagctcaggcttgccg
atttttgccctgtccccaaaccaggcaacattgaacaaagcggctctttatcgtggtgtg
acacctgtgtcattctcatcccaagaatacaatgtcgacaacatcatctctggtttagtc
gatcacgttaaatctctaggctacattgccgatggtgaccttgtgatcgtgacgaaaggc
gatcaccttgtcagctatggcacaaccaatgctatgaaaattgtcaaagtgggcgacatc
gtctaa

DBGET integrated database retrieval system