KEGG   Microlunatus phosphovorus: MLP_12700Help
Entry
MLP_12700         CDS       T01535                                 

Gene name
mdh
Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
mph  Microlunatus phosphovorus
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MLP_12700 (mdh)
   00620 Pyruvate metabolism
    MLP_12700 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    MLP_12700 (mdh)
  Energy metabolism
   00680 Methane metabolism
    MLP_12700 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MLP_12700 (mdh)
Enzymes [BR:mph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     MLP_12700 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1391465..1392454)
Genome map
AA seq 329 aa AA seqDB search
MSTPVKVAVTGAAGQIGYSLLFRIASGSLLGPDTPVQLRLLEITPALKALEGVVMELDDC
AFPLLAGVETGDDPNVVFDGANIALLVGARPRTKGMERGDLLEANGAIFKPQGAALNAHA
ADDIKVLVTGNPANTNALIAKSNAPDIPAERFNALTRLDHNRALAQLAAKTGSTVNDITK
MTIWGNHSATQYPDVFHSEVNGRNAAELIDDQDWLESTFIPTVQQRGAAIIAARGASSAA
SAANATVDHMRDWVLGTPEGDWVSMAVPSDGSYGIAEGIITSFPCTTAGGAYNIVQGLEL
NEFSRAKIDASVAELQGEREAVQALGLVE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacacccgtcaaggtcgccgtcaccggagcagccggtcagatcggctacagcctg
ctgttccgcatcgccagcggatcgctgctgggtcctgacaccccggtgcagctgcggctg
ctggagatcaccccggccctgaaggcactcgaaggtgtcgtaatggagctcgacgactgt
gccttcccattgctcgcaggggtggagaccggcgacgatcccaatgtggtcttcgacggc
gccaacatcgcgctgctggtcggcgcccgaccacggaccaagggcatggagcggggcgat
ctgctggaggccaacggcgcgatcttcaagccgcagggcgccgcgctgaacgcgcatgcc
gccgacgacatcaaggtgctggtcaccggcaatccggccaacaccaacgccctgatcgcc
aagagcaatgcacccgacatccccgcggaacggttcaacgcgctcacccgattggaccac
aaccgggcccttgcccaactggctgccaagaccggcagcaccgtcaacgacatcaccaag
atgacgatctggggcaaccattcggccacgcagtacccggacgtcttccactccgaggtg
aacggccggaacgccgcggaactgatcgacgatcaggactggctggagtcgaccttcatc
ccgaccgtgcagcagcgtggcgccgcaatcatcgcggctcgcggcgccagctctgcggcc
agcgcggcgaacgccaccgtcgaccacatgcgtgactgggtgctgggcacccccgagggc
gactgggtgtcgatggcggtgccgtccgacggctcgtacgggatcgcggaagggatcatc
accagcttcccctgcaccacggccggcggcgcctacaacatcgttcaggggttggagctc
aacgagttctctcgcgccaagatcgacgccagtgtcgccgagctgcaaggcgagcgggag
gccgtgcaggccctcggcctggtcgagtga

DBGET integrated database retrieval system