KEGG   Mycobacterium phlei: MPHLCCUG_00299Help
Entry
MPHLCCUG_00299    CDS       T04305                                 

Definition
(GenBank) Putative DNA ligase-like protein
Organism
mphl  Mycobacterium phlei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(295387..296421)
Genome map
AA seq 344 aa AA seqDB search
MLAKSVTTIPPEMFYEPKWDGFRSICFRDGDDIEFGSRNERPLTRYFPELVDAARHELPN
RCVIDGEIVIAAGNGLDFEALQLRLHPAASRVAMLAAQTPASFIAFDLLALDETDYTQRP
FGERRAVLESIFTTGTERFHLTPATTDLATAQRWFDEFEGAGLDGVIAKPLDLTYQPDKR
VMFKIKHRRTADCVVAGYRLHKSGPDAVGSLLLGLYADDGSLASVGVIGAFPMAKRRELF
TELQPLVTTFDEHPWNWAAHADPDVVRRYGGGSRWNAGKDLSFVPLRPERVVEVRYDHME
GTRFRHTAQFNRWRPDRDPRSCTFAQLDQPVTFQLDEIIPGLGG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgctggccaagtcggtgacgacgatcccaccggagatgttctacgaaccgaagtgggac
ggcttccgctcgatatgcttccgcgacggtgacgacatcgagttcggcagccgcaacgaa
aggccgctgacccgttattttcccgagctcgtcgacgccgccagacacgaactgccgaac
cgctgcgtcatcgacggcgagatcgtcatcgccgcgggcaacggcctcgacttcgaggcg
ctgcagctgcgcctgcatcccgccgcatcccgggtcgccatgctggccgcccagacgccg
gcgtcgttcatcgcgttcgatcttctcgccctcgacgaaaccgactacacccaacggcct
ttcggcgagcgccgcgccgtcctcgagagcatcttcacgaccggcaccgagcggttccat
ctcacccccgccaccaccgatctcgccaccgcgcaacgctggttcgacgagttcgagggc
gcgggcctcgacggcgtcatcgccaaacccctcgacctgacctaccagcccgacaaacga
gtgatgttcaagatcaagcaccggcgcaccgcggactgcgtcgtcgccggttaccgcctg
cacaagtccggccccgacgccgtcggctccctgctgctcggtctctacgccgacgacggc
agcctggcctccgtcggcgtcatcggcgcgttcccgatggccaagcgtcgtgagctgttc
accgaactgcagccactggtaaccactttcgacgaacacccgtggaactgggccgcccac
gccgaccccgacgtagtgcgtcgctacggcggcggctcccggtggaacgccggcaaggac
ctgtccttcgtaccgctgcggcccgagcgcgtcgtcgaggtccgctacgaccacatggaa
ggtacgcgcttccgccacaccgcgcagttcaaccgctggcgacccgaccgcgacccccgc
tcctgcaccttcgcccaactcgaccaacccgtgactttccagcttgacgagatcattccg
ggtctcggcggctag

DBGET integrated database retrieval system