KEGG   Microcystis panniformis: VL20_4123Help
Entry
VL20_4123         CDS       T04037                                 

Definition
(GenBank) Bicarbonate transport system permease protein
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
mpk  Microcystis panniformis
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:mpk00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    VL20_4123
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    VL20_4123
Transporters [BR:mpk02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    VL20_4123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3533503..3534330
Genome map
AA seq 275 aa AA seqDB search
MAVSISRRSQGQKWVKDLKKKLSKLATSAIALLIFLLLWQILCFSPDAPLPSPTKVVSET
WELIINPFFNNGGTDVGLFWQILASLQRVAVGFTLAAIVGIAAGILIGSSALIYDAIDPI
FQILRTVPPLAWLPISLAAFRNNEPSAIFVIFITAIWPIIINTAVGVQQVPQDYKNVSRV
LKLSKVEYFFNILFPATVPYVFTGLRIGIGLSWLAIVAAEMLIGGVGIGFFIWDAWNSSM
ISEIILALIYVGIVGFLLDRLMAYIAKLVVPEENK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttctatttctcgtcgttctcaaggtcagaaatgggtaaaagacctgaaaaaa
aaattatccaaactagcaacttcggcgattgctttattaattttccttctcctctggcaa
attctctgttttagtcccgatgctccccttcctagtcccaccaaagtggttagcgagacc
tgggaattaattattaatcccttcttcaataatggtggcacggatgtggggttattctgg
caaattttagctagtttacaacgggtggccgtcggtttcacccttgccgctattgttggc
atcgctgcgggtattttaatcggtagtagcgccctaatttatgatgcgatcgatccgatt
ttccaaatcctgcgtaccgttccccccctagcttggctacccatctccctagcggctttt
cgtaataacgaacctagtgccatatttgtaatttttattacagcaatttggccaattatt
attaacacggccgtgggagtacagcaggttccccaagactataaaaacgtctctagagtg
ttgaaattatccaaagttgaatactttttcaatattctttttcccgccaccgttccctac
gttttcaccggattaagaatcggtatcggtttatcttggttggcgattgtagcggcagaa
atgctgatcggtggcgtgggaattggcttctttatctgggatgcttggaatagttccatg
atcagtgaaattatcctcgccctgatttatgtgggtattgttggtttcttactcgatcgc
ctcatggcctacatcgctaaattagttgtacccgaagaaaataaatag

DBGET integrated database retrieval system