KEGG   Microcystis panniformis: VL20_5586Help
Entry
VL20_5586         CDS       T04037                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mpk  Microcystis panniformis
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VL20_5586
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VL20_5586
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    VL20_5586
   00680 Methane metabolism
    VL20_5586
Enzymes [BR:mpk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     VL20_5586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4915889..4918945)
Genome map
AA seq 1018 aa AA seqDB search
MSVLVPSTETEQDIFSTSNLFLQQRLKLIEDLWKEVLVSECGQELVDLLELLRHLCSEEG
QVTDDSPEAMIAKMIEDLELGEAIKVTRAFALYFQLINIIEQHYEQRDQQLLRRTVIGEE
NESPKTDPPQKSLLATIVGADWLEKTLNESDHSGPKSGLFHWLFPYLKQVNVPPQEIQRL
LDQLDIRLVFTAHPTEIVRHTIRIKQRRISGILEKLDQAEEIFRSMGLTNSREAQTVTKQ
LKEEIRFWWRTDELHQFKPTVVDEVDYALHYFDEVLFDSLPQLTLRLQQSLQSSFPRLQA
PKNNFCRFGSWVGGDRDGNPSVTPEVTWKTCCYQRNLVIKKYLDAIRDLTSILSASLHWC
HVLPELLDSLDRDKQQMPEIYSQLAIRYRQEPYRLKLAFIQKRLENTRDRNNRLNDPEER
QLLTKLNETNIYRSGSEFLAELQLLQRSLLQTGLSCQELDRLIAQVEIFGFVLTQLDFRQ
ESTRHAECIEEIAAYLGVLPKPYGQLTESEKIAWLVAELKTRRPLIPREMPFSERTCETI
ETLRVLRSLQGEFGLEICQTYIISMTNEASDVLEVLLLAQEAGLYDPATSRSSLRIVPLF
ETVDDLKHAPGIMQTLFELPLYRAALAGGYDHLGALNGEEVTPEPAILEPGNLQEIMVGY
SDSNKDSGFLSSNWEIHKAQKALQKTAKQYGLDLRLFHGRGGSVGRGGGPAYAAILAQPR
GTINGRIKITEQGEVLASKYSLPELALYNLETAVTAVIQASLLGSGFDDLEPWNRIMEEL
ATRSRQTYRSLIYEEPDFLDFFLSVTPIPEISLLQISSRPARRKSGQQDLSTLRAIPWVF
SWTQTRFLLPAWYGLGTALQMFLDDSPNRNLELLRHFYHKWPFFQMVISKAEMTLSKVDL
QIAYHYVSELSKQEDRERFQRLFERIKEEYNRTSEIVLQITGEKNLLDNDPNLQRSVQLR
NGSIVPLGFLQVSLLKRLRQYNSQAQSGVIHFRYSKEELLRGALMTINGIAAGMRNTG
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccttgtcccctcaaccgaaaccgaacaggatattttcagcacttccaacctg
tttctgcagcaaagactgaaattaatcgaagatttatggaaagaagtcttagtctccgaa
tgtggtcaagaattagtcgatttactggaattactgcgccatctctgttctgaggaagga
caagtgaccgatgatagtccggaagcaatgatcgccaaaatgatcgaagacttggaacta
ggggaagcgatcaaagttacccgcgcttttgccctctatttccagttaataaatataatc
gaacaacactacgaacaaagggatcagcaactactgcgacggacggtgatcggggaagaa
aacgaaagtcccaagacagacccaccgcaaaaaagccttttagccaccattgtcggggct
gattggctagaaaaaaccctgaacgagtccgatcactccggcccaaaatcgggactattt
cactggttatttccctatctcaaacaggtgaacgtccccccccaggaaatccagcgtctt
ctcgatcaattagatattcgtctggttttcacagcccaccccacggaaattgtccgtcat
accattcgcattaaacagcgccgcatctcgggcattctcgaaaaactcgaccaagcagaa
gaaatctttcgcagtatggggttaactaactccagagaagcacaaacagtcaccaaacag
ttaaaagaagaaattcgtttttggtggcgaacagatgaactacatcaatttaaacccacc
gtcgtcgatgaggtggattatgccctgcactacttcgatgaagttctcttcgattcccta
ccccagttaaccctgcgtctgcagcaaagcctacaatcctcctttccccgtttacaagcg
ccgaaaaataacttctgtcgcttcggttcttgggtggggggggatcgggatggcaatccc
tccgttacccccgaagtcacctggaaaacctgctgttatcagcgcaatctcgttattaaa
aaatatctcgatgctattcgcgacctgaccagtattttaagtgcctccctgcactggtgt
cacgtcttgccggagttgctggactccctggacagagataagcagcaaatgcccgaaatc
tatagccagttagcaatccgctaccgtcaggaaccctatcgcctcaaattggcctttatt
caaaaacgtctggaaaatacacgcgatcgcaataatcgcctcaatgatccggaagaacga
cagttattaactaaactcaacgaaaccaacatctatcgctctggttccgagtttttagcc
gaattacagctattacagcgcagtctcttgcaaaccggtctttcctgtcaagaactcgat
cgactgatcgcccaagtggagatttttggctttgtcctgactcagttagattttcggcaa
gaatccacccgtcacgccgaatgtatcgaagaaatcgccgcctatctcggagttttaccc
aaaccctacggccaattaaccgaatcagaaaaaatcgcctggttagtggcggaattaaaa
acccgtcgccccttaattccccgggaaatgcccttctcggaaagaacctgcgaaaccatt
gaaaccctgcgagttttaagaagtctgcaaggggaattcggtctggaaatctgccaaacc
tacattatcagcatgaccaacgaggccagcgatgtgctagaagtgctgttattagcccaa
gaagccggtttatacgaccctgccactagccgcagttccctccgcattgttcccctcttt
gaaaccgtcgatgacctcaaacacgcccccggcatcatgcagactttgtttgaattgccc
ctctaccgggcagccctagccggcggttacgaccatttaggggctttaaacggggaggaa
gtgaccccggaaccggccatcctcgaaccgggtaatttacaggagattatggtgggttac
tccgatagtaataaggattccggctttttaagcagtaattgggaaattcataaggcccag
aaggctttacaaaaaaccgctaaacaatacggcttggatctacgtctttttcatggccgg
ggcggttccgtcggtcggggtggtggacctgcctacgccgctatcctcgcccaaccccgg
ggaacgattaacggtcgcattaaaatcaccgaacaaggcgaggttttagcctcgaaatac
tctttaccagaattggccttgtataacctcgaaacggccgtaacggcagtcatacaggca
agtttactgggcagtggttttgatgatctcgaaccctggaatcgcatcatggaggagttg
gccacccgttcacggcaaacctatcgcagtttgatttatgaagaaccggactttttagac
ttctttctgtccgtaactcccattcctgaaattagtcttttacagattagttcccgaccg
gcgcgccggaaaagtggtcaacaggatttaagtaccctgcgggcaattccctgggtattt
agttggactcaaacccgttttcttttaccagcttggtatggtttagggacagctttgcag
atgtttctcgatgattctcctaaccgaaatttagaattgttgcgccatttttatcacaag
tggcccttcttccagatggtgatttctaaagcagaaatgactctatcgaaggtggatcta
cagattgcctatcactacgtcagtgaactttctaaacaggaagatcgagaacgttttcaa
cgtctgtttgaaaggatcaaagaggaatataatcgcactagcgagattgttctccagatc
accggcgagaaaaatttattagataatgatccgaatttacagcgctcggtgcagttacgc
aacggttcgatcgttcccctcggtttcctacaggtgtctctcctcaagcgtttacgtcaa
tacaatagtcaagctcaatccggtgtgattcatttccgctattctaaagaggagttatta
aggggcgctttaatgacgattaatggtattgccgcagggatgagaaataccggttga

DBGET integrated database retrieval system