KEGG   Micromonas pusilla: MICPUCDRAFT_53128Help
Entry
MICPUCDRAFT_53128 CDS       T02696                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
mpp  Micromonas pusilla
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    MICPUCDRAFT_53128
Enzymes [BR:mpp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MICPUCDRAFT_53128
DNA repair and recombination proteins [BR:mpp03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     MICPUCDRAFT_53128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 1197 aa AA seqDB search
MATPRDQPLASTSDAVGALTPSPPRNMRDVAFEDLCALLDAIRNVNRSGRKGAKRKREIL
DGFHAEMGMRRDAPREGAFDMYRLVLPQMDKERAAYGLKEAALARCLGLALGLKRGVSPD
FIALEAWRKQGTGVFALTAFQVCHKHMPDNIPASGRRATVGEVNDALDKLAGKKATDEKV
PILRALLEGLGAVQMRWLVAIILKDLKLGCGESFLLRHYHPDAEDLYNVCCDLRRVVTTL
NVRDKPFERQDLSPGSLVNAMNSSRVNATEKAFKKMQKRKATFVIETKFDGERIQVHRTG
EREFKYLTRNNIDFHPRGYSVLDRLFRARLKKTTCVLDGELVIWNKREKRYLEFGYLKGF
INAIGRSCPAEAIIEKQSMYNSRVRDADGGGGDGDGDGSDGDGDGSESDDDDDDRAGGDR
GETLKTANDPGQYRLADLELVYVAFDVLYDDDHSVIHRPLSERHDVLRGMFKPLGAGHDA
GAHARARERARGEETDDDDDAPVADQSDGTVRLGPRGGASKGRVQIHVPAKDPTEPVNPD
CVVASMLGEIETYFWRAVDRGDEGLIIKDLGSKWEPGARGDSWLKIKPDYLPTEDLDVVI
IGGFYGTGRQRGGKIAEYLLGIVETPTREGARPTRVMSFSKVGTGMSVDVMQRLREKLGP
HMLPAGKGYNPPTMYDVTGAAAETPDVWIDRPENSVVLTVKADIRLVRTMTFRADVSLRF
PRVTGVRWDKPWHDALSNEQLAVMQDEGGIGVAVGRAGRFGNRTAAEGGDGAGYAKQPSS
KRHKAAPARDRRLPAHLAVADTSAVTREGNILRSLDVRILAGGDQYSAGAFKAELAALVK
SQGGKTSEARSIHWSPYDPVRVVNAASHPGLTHVVASPAARGTIAFEAVKRAGGVDVLTP
QWLRDCVARGEIFEPTPKHRLVTCAATVERSAGAMDRFGDDHYVDVDADDAAALVHGDRM
TSAMNQRRGDDDDDDFDFEAEEVAMQLAAMSDEDDDDGGDDDGGGGGAETGNPARAFRTF
ERCVFLVVTAPRGVDVSRLPFIDAALDVARVKRVDVHRDESEDDGAHGETTRRAAPAPTT
TAAAIIALTAADGAGAAGEDADARRDEEMEAERSTRADAARLARSLRLRGARVASGCRVG
VTHVVAFEPGGGGGGGGGGGDRSDDATGDGETRWGGAMVVSPAWARARMAEGARVVP
NT seq 3594 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccccgcgcgaccaaccgttggcgtcgacctcggacgccgtcggcgcgctgacg
ccgtcgccgccgcggaacatgcgcgacgtcgcgttcgaggatctgtgcgcgctgctcgac
gcgattcgcaacgtgaaccgaagcggcaggaagggcgcgaagcggaagcgcgagatcttg
gacgggttccacgcggagatggggatgcgccgagacgccccgagagagggcgcgttcgat
atgtaccggctcgtgctgccgcagatggacaaggagcgcgcggcgtacggcctgaaagag
gccgcgctcgcgcgatgcctaggcctcgcgctcgggttgaaacgcggcgtctccccagac
ttcatcgcgctcgaggcgtggaggaagcaagggaccggtgtcttcgcgctgacggcgttc
caggtgtgtcacaagcacatgccggataacatcccggcctcgggtcgccgcgcgacggtc
ggcgaagtcaacgacgcgcttgataagctcgcggggaaaaaagcgacggacgaaaaagtg
ccgatactccgcgcgctcttggaaggcctcggcgccgtgcagatgcggtggctcgtggcg
atcatactgaaagacctgaagctcggatgcggggagagttttctgctcaggcactaccac
ccggacgcggaggatctgtacaacgtgtgctgcgacttgagacgcgtcgtcacgacgttg
aacgtccgggacaagccgttcgaacgccaggacctctcccccgggtctctcgtgaacgcg
atgaactcgtccagggtgaacgcgacggagaaggcgtttaagaagatgcaaaagaggaag
gcgacgttcgtgatcgagaccaagttcgacggcgaacggattcaagtccacaggacgggc
gagcgcgagttcaagtatctcacgaggaacaacatcgacttccatccgcgcgggtacagc
gtgctcgaccgactgttccgagcgcggttgaagaagacgacgtgcgtcctcgacggcgag
ctcgtgatctggaacaagagagagaagagatacctcgagtttgggtacctgaagggtttc
atcaacgcgatcgggcggtcgtgtccggcggaggcgatcatcgagaagcagtcgatgtac
aacagccgcgtgagggacgcggacggcggcggcggcgacggcgacggcgacggcagcgac
ggcgacggcgacggcagcgaaagcgacgacgacgacgacgaccgcgccggcggcgaccgc
ggcgagacgttgaagaccgcgaacgacccggggcagtacagattggccgacttggagctc
gtctacgtcgcgttcgacgtgttgtacgacgacgaccactccgtgattcaccgcccgctg
tccgaacgacacgacgtccttcgagggatgttcaagccgctgggcgcggggcacgacgcg
ggcgctcacgcccgcgcccgcgagcgcgcgcgcggggaagagaccgacgacgacgacgac
gccccggtcgcggaccagagcgacgggacggtccggttgggcccgcgaggcggcgcgtcg
aagggaagggtgcagatacacgtcccggcgaaggatcccacggagcccgtcaaccccgac
tgcgtcgtcgcctcgatgctcggggagatcgagacgtacttctggcgcgcggtcgaccgc
ggcgacgagggtctcatcatcaaagacttggggtcgaagtgggagcccggcgcgcgcggg
gactcgtggttgaaaatcaagcccgattacctcccgacggaggatctcgacgtcgtcatc
atcggcgggttctacggcaccggacgccagaggggcgggaagatcgcggagtacctcctc
gggatcgtggagacgccgacgagagaaggcgcgaggccgacgcgggtgatgtcgttcagc
aaagtcggcacggggatgtccgtggacgtgatgcagagactccgagaaaaattagggccg
cacatgcttcccgcgggcaaagggtacaacccgccgacgatgtacgacgtcaccggcgcc
gcggcagagaccccggacgtgtggatcgaccgcccggagaactccgtggtgttgaccgtc
aaggcggacatccggctggttcgaacgatgacgtttcgcgcggacgtctctctgcgattc
ccccgcgtcaccggcgtgcggtgggacaagccgtggcacgacgcgctgtcgaacgagcag
ctcgcggtgatgcaagacgagggcgggatcggcgtcgcggtgggcagggcaggacggttc
gggaatcgaaccgccgcggaaggcggcgacggcgcggggtacgccaagcagccgagcagc
aaacggcacaaggcggcgcccgcgcgcgaccgaagactccccgcgcacctcgcggtcgcg
gacacgtccgcggtcacgcgcgaggggaacatccttcgcagcctcgacgtgcggatcctc
gccggcggcgaccaatactccgccggggcgttcaaagccgagctcgcggcgctcgtgaaa
tcccaaggcgggaaaacctccgaggcgcgttctatacactggtccccatacgaccccgtt
cgcgtggtgaacgccgcgagccaccccgggttgacgcacgtcgtcgcctcgcccgcggct
cgcggcacgatcgcgttcgaggctgttaagagagcgggcggcgtggacgtgttgacccct
cagtggctgcgcgactgcgtcgcgcgcggggagattttcgaaccgacgccgaagcaccgt
ttggtgacgtgcgcggcgaccgtcgagcgctccgccggcgcgatggatcggttcggcgac
gatcactacgtcgacgtcgacgcggacgacgccgcggcgctggtgcacggcgacaggatg
acgagcgcgatgaatcagcggcgaggcgacgacgacgacgacgacttcgacttcgaagcc
gaggaggtggcgatgcagctcgcggcgatgagcgacgaggacgacgacgacggcggcgat
gacgacggcggcggcggcggcgcggagacgggtaacccggcgcgagcgttccggacgttc
gagcggtgcgtcttcctcgtcgtgaccgcgccgcgcggggtggacgtgtccaggctgccg
ttcatcgacgccgcgctggacgtcgcgcgcgtgaagcgcgtcgacgtccatcgcgacgag
agcgaggacgacggggcccacggcgagacgacgagacgcgcggcgccggcgccgacgacg
acggcggcggcgatcatagcgctcaccgccgcggacggcgcaggcgccgcgggggaggac
gcggacgcgcgtcgcgacgaagagatggaggcggagcgatcgacgcgcgcggacgccgcg
cggctcgcgcggtcgctgaggctgcgaggcgcgcgcgtcgcgtcggggtgtcgcgtcggg
gtcacgcacgtcgtcgcgttcgagccgggcggcggcggcggcggcggcggcgggggcggg
gatcgatcggacgacgcgacgggcgacggcgagacgcggtgggggggcgcgatggtcgtg
tcccccgcgtgggcgcgtgcgaggatggccgagggcgcgcgcgtcgtcccgtga

DBGET integrated database retrieval system