KEGG   Moorea producens: BJP34_26130Help
Entry
BJP34_26130       CDS       T04499                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mpro  Moorea producens
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mpro00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BJP34_26130
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJP34_26130
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BJP34_26130
   00680 Methane metabolism
    BJP34_26130
Enzymes [BR:mpro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BJP34_26130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(7127654..7130872)
Genome map
AA seq 1072 aa AA seqDB search
MSFFPSPSNQDSTFPATSDLFLRHRLKIVEDLWESVLLSECGQELVDLLKQLRELCSPEG
QATEDPQSSVADLIQQLDLNEAIRASRAFALYFQLINIVEQHYEQRNQQLSRRRSYRRST
EPELTPFSEGILTKNGNSSFSTVTTVEKEVEIGNEGTQPGGAVSNVIEKSHQENQGSERK
LGLLDWLFPHLHKQNVPPGQIQRLIDNLDIRLVFTAHPTEIVRRTIRGKQRRMAKILEQL
DQAEQTYGTLGITSSWEVTECSQKLMEEIRLWWRTDELHQFKPGVLDEVDYTLHYFHEVL
FDTIPQLYSRFKQALKGSFPWLNPPAKNFCHFGSWVGSDRDGNPFVTPQITWQTACYQRD
LVLGKYINEVSHLTELLSLSLHWCDVLPELLDSLEQDRSQLPEVYEQLAIRYRQEPYRLK
LTYVKQKLENTRERNQQLANGMPVPDEMANGKSWSFYRSGEEFLAELKLIESNLVETGLN
CRELDNLICQVEIYGFYLAHLDIRQESSRHSEALSEIAEYLQVLPKPYNLLSESEACLWL
TAELRTRRPLIPTELPFSEKTCETIETFRMVRQLQQEFGPQICQTYIISMSHTASDLLEV
LLLAKEAGLYDPATGQGTIRVVPLFETVEDLKRAPAVMKSLFELPLYRASLAGGYQQWQV
SPNNRQLNNLPYSNAKAEQSNNPGLKAVGHAARTATLREQALTSPNLQEVMLGYSDSNKD
SGFLSSNWEIHKAQKALEHVAQEYGIVLRIFHGRGGSVGRGGGPSYEAILAQPGRSINGR
IKITEQGEVLASRYSLPGLALYHLETIATAVIQASLLNNGFDDIQPWNEIMEELAQTSRT
HYRALIHEQPDLVDFFHQVTPIQEISQLQISSRPARRKSGKKDLSSLRAIPWVFSWTQSR
FLLPSWYGVGTALQSFVDQDPEENINLLRCFYSKWPFFKMVISKVEMTLAKVDLQIAHHY
LKELSNPEDLERFEHLFEQIAKEFNLTCNLVLTITGHQTLLDGDPNLQRSVQLRNGTIVP
LGFLQVSLLKRLRQHSNQVTLGVVQSRYSKGELLRGALLTINGIAAGMRNTG
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgagttttttcccatctccatctaatcaagattcaaccttcccggctacctctgacctg
tttctgcgccatcgacttaaaattgtagaggatttgtgggaatctgttctcctatctgaa
tgtggtcaggaactcgttgatttactcaagcaactgcgggaattgtgttctccagaagga
caagcgactgaagatcctcaatcctcagttgctgatttaatccaacagcttgaccttaac
gaggctatccgggcatcacgagcgtttgctctttactttcagctgatcaatattgtcgaa
caacattatgaacagcgaaatcaacaactctcaagacgccgttcctaccgaagaagcact
gaacccgagttaacccccttcagcgaaggtattttaacaaaaaatggtaattcgtctttc
tcaactgtgacaacagttgagaaagaggtggaaataggcaatgaggggactcaaccaggg
ggtgccgttagcaatgttatcgaaaagagccaccaagaaaaccaaggatccgaaagaaaa
ttaggactgctagattggctatttccccacttgcacaagcagaatgttccacctggtcaa
attcagaggctgattgacaatcttgatattcgcttggttttcactgctcaccccacagaa
atcgtccgtcgtaccattcggggtaaacagcgacggatggctaagattctggaacaatta
gaccaagcggagcaaacctatggtaccttgggaatcacttcctcctgggaggtgactgaa
tgtagccaaaagcttatggaagaaattcgcctctggtggcgcacggatgagctacatcag
tttaagccgggagtacttgatgaggtagattacactcttcactacttccacgaagtactg
tttgatactataccccaattgtatagtcgcttcaagcaagcgttgaagggttcattcccc
tggctgaacccaccagctaagaacttctgtcattttggctcttgggtgggctcagaccgg
gatggtaatccttttgtgactccccaaattacctggcaaactgcctgctatcaacgagat
ttggtgctgggtaaatatataaatgaagttagccatctaaccgaattattgagtctgtcg
ttgcactggtgtgatgtgctaccggaactgttggactctctagaacaagaccgctctcaa
ttgccagaggtttacgaacagctggccattcgctatcggcaagaaccctatcgacttaaa
ctgacctacgttaagcaaaaactggaaaatacccgtgagcgaaaccaacagcttgccaat
ggtatgcctgtaccagatgagatggctaatggtaaaagctggagtttttaccgctctgga
gaagaattcttggcagaactaaagctgattgagagtaatctggtggaaactgggttgaac
tgtcgtgagttagacaatttaatctgtcaggtggaaatttatggcttttacctagctcac
ctagatattcgccaggaaagttctcgccactcagaagccctcagtgaaattgctgagtac
ctgcaagttttgcctaagccctacaacttgctatcggaatccgaagcatgcttgtggtta
accgctgagttgcgaacccgacgtccattaatcccaacagaactgccattttcggaaaaa
acctgcgagactatcgaaaccttccggatggtgcggcagctgcaacaagagtttggtccc
caaatctgccaaacctacatcatcagcatgagtcatacggccagcgatttgttagaagtc
ctcttgttggcgaaggaagctggtttgtatgacccggccactggtcagggaaccattcgc
gtggtgccactgtttgaaacagtggaagaccttaagcgtgctccagcagtgatgaaatcc
ctgtttgagctacccttgtatcgtgctagtttggctggtggatatcaacagtggcaggtt
agcccaaataaccgtcaactaaataacctaccctactcgaacgccaaagctgaacaatca
aataaccctggccttaaggccgtaggccacgctgcgcgaacggccacgctacgggaacaa
gctttaacctctcctaacttacaagaggtaatgctcggctactccgacagtaacaaagat
tctgggttcctcagtagcaactgggaaatccacaaagctcagaaagccttagagcacgtg
gcccaagagtacggtattgttttacggatcttccatggtcgtggtggttcagtgggtcgt
ggtggtggcccatcttatgaagctatcctggcgcaaccgggtcgcagtatcaatggccga
atcaaaattaccgaacagggggaagtccttgcttctaggtactctcttccaggactagcg
ctctatcatctcgaaacaatagcgacagcagtgattcaagctagcttactcaataatggc
tttgatgatatccagccctggaatgaaattatggaggagttagctcagacctcccgtacc
cattaccgagctctgattcacgagcaaccagatctggtagatttcttccatcaagtgaca
ccgattcaagaaattagccagttgcaaattagttctcgacctgcacggcgtaaatcaggg
aagaaggatttaagcagtctgcgggcaattccttgggtctttagctggactcaaagccgc
ttcttgctaccgagctggtacggtgttggcactgcactacaaagctttgtcgatcaggat
ccagaggagaatatcaacctattgcgctgtttctactcaaaatggcccttcttcaaaatg
gttatttccaaagtagagatgaccttagccaaggtggatttacaaattgctcaccactat
ctcaaggaactttcaaaccctgaagacctggaacgcttcgagcatttgtttgagcaaatt
gctaaggaatttaaccttacctgcaatttagtcctgacgatcacaggacaccaaacactg
ctagatggcgacccaaatttacaacggtctgtacagttgcgtaatggtaccatcgttccc
ttaggatttttacaggtatctttgctcaaacgcctgcgtcaacatagcaaccaggtaaca
ttgggtgtggttcaatcccggtatagtaagggagagttactacgaggagccttattgacg
atcaacggtattgctgctggcatgcgtaatactggctga

DBGET integrated database retrieval system