KEGG   Moorea producens: BJP34_26565Help
Entry
BJP34_26565       CDS       T04499                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mpro  Moorea producens
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:mpro00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BJP34_26565
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BJP34_26565
Enzymes [BR:mpro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     BJP34_26565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7230909..7231256
Genome map
AA seq 115 aa AA seqDB search
MKTLPKERRYETLSYLPPLSDSQIMRQVEYILAEGYIPAIEFNESSEPEIYYWTLWKLPL
FKATSPKDVLAEVDECRSEYRDCYIRVVGFDNVKQCQVLSFIIHKPNDGVSRSRW
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattaccaaaagagcgtcgttacgaaaccctttcctacttaccccccctgagt
gactctcagattatgcggcaagtggagtacatcttagcggaaggttacatccctgcgatc
gagttcaacgaaagctctgaaccagagatttactactggacattatggaaactgcctttg
ttcaaggctacttcacctaaagatgtgctagctgaagtggatgagtgtcgctctgaatac
cgcgactgctatatccgggttgtgggttttgataacgttaagcagtgccaagttctcagt
ttcatcattcacaagcctaatgacggtgttagccgcagccgttggtaa

DBGET integrated database retrieval system