KEGG   Moorea producens: BJP34_27465Help
Entry
BJP34_27465       CDS       T04499                                 

Definition
(GenBank) hypothetical protein
Organism
mpro  Moorea producens
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation Thioesterase PP-binding AMP-binding_C Abhydrolase_1 Abhydrolase_6 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AOX02682
UniProt: A0A1D8TYF6
LinkDB All DBs
Position
complement(7475363..7481455)
Genome map
AA seq 2030 aa AA seqDB search
MPNQLAYIFLQNGETPSGSLTYGELDRQATAIAFHLQSMEGERALLLYPSGLEFITAFFG
CLYAGVIAVPVYPPRRNQKLSRLLNIVNDAQADVALTTTSILADIEQRWASDAELAQLQL
VATDTIVANGQEFVPQSVTRSSLAFLQYTSGSTGTPKGVMVTHGNLIQNSTNLDRGWEHN
SDSVIVTWLPTFHDMGLIYGMLQPIYKGCKCIMLPPASFIQKPIRWLKAISDYGGTHSGA
PNFAYALCVEKTTPEQRNQLNLSSWSMALNGAEPVRADVLEKFAQVFEVSRFNKRAFCPG
YGMAEATLKISAVRAKDKPIYYHIDATALEQNYVVEFPDEKHLGIGKRTLVGCGRSEIDT
KVIIVNPQTCCRSASEEIGEIWVSGGSVASGYWNRPEATQKTFQAYLKDTGDGPFLRTGD
LGFFSKGELFVTGRLKDLIIIRGRNHYPQDIELTVENSHPSLRSHCSAAFSVERDGEERL
VVAGEVERTHLRKLNTEEVVREIQIALSTEHELDVDGVVLLKTGSIPKTSSGKIQRRACK
QGFLEGSLNVVGQWQKTLSQHEYVAPRTPTEEIIANIFASVLGVKDVGIHDNFFEIGGHS
ILATQLISQLRVTFNREIPLRQVFESPTIALISPKLTQLLTTENQLSLPLIQPRTDSEQL
PLSSAQKRLWFLNQLEGSSATYNIPAAFRITGNLIINALEQALSEIISRHEVIRTSFSTI
NGKPIQVIHPDSTININVVDLQQYPEPERETILQQLVQQEATTPFDLEVAPLIRCKLWQL
DTTEYVLVLTMHHIVSDGWSMGILIEELSSLYQAFAASEPSPLPELAIQYADFALWQRQW
LTGEILEIQLNYWKQELEGAPELLQLPTDRSRPHVQSYQGSSESFSLTAELTQKLQQLSR
NAGSTLFMTLQAAFATLLYRYSGQFDILIGSPIANRNRREIEPLIGFFVNTLVLRTRFEH
NPSFSQLLRQVRETTLNAYEHQDVPFEQVVEALQPQRSLSHSPLFQVMFVLQNAPMGKLD
LPGVTLSQFNQHSTIAKFDLTLSMTETEMGLVGTWEYNTDLFDGSTIKRMATHFQNLLSA
IVENPQLRVGEFPLLSEGERHQLLLEWNDTASEYPKEKCIHQLFEEQVEKTPDAIAVVFD
QQQLTYHQLNQRANQLAHHLQNLGVGPEVLVGICVERSVQMVVGLLGILKAGGAYVPLDP
NYPHQRLSYMLADSGVEVLLTQQSLLESLPSHTAQMVCLDSDWRAIEQYSGQNLDVGVTS
DNLAYVIYTSGSTGKPKGTMILHSGVGNYLSWCTKAYNVADSEGSTVNSSIGFDATITSL
FSPLLVGRKVVLLPEEGEIEALKAALCSGTKFSLVKITPAHLEILSYLLAHEQVTIENKA
FIIGGEALSANHIKFWQKYAPQIRLINEYGPTETVVGCCIYEVGGKTFSGGNIPIGRPIA
NTQIYILDKHLQPVPIGVPGELYIGGDGLARGYLKRPELTSEKFIHNPFCNSKSQRLYKT
SDLARYLRDGNIEFLGRIDNQVKIRGFRIELGEIEAVLSSHPHIQQTVVIAREDIPGNKR
LVAYIVSQSESLSTNQLREFLKQKLPEYMVPSAFVTLDTLPLTPNGKVDRKSLPAPDGVV
TSVEEYVAPRTPTEEIIANIFANVLGLQDVGIHDNFFELGGHSLLAVRLMSQIKQQFQIN
LPLATLFQSPTIEQLASLLGSSVNTQNPILVGIKTSGNQPPLFCIHPVGGNLLCYAELAR
HLDQDYPVYGLQSLGLDGQQQPLTSVEEMASHYIQAIQQIQPQGSYHLIGWSFGGVIAYE
MAQQLQTKNTSVALLTLIDSYVPTLIRKPSEIDQAMIVNLFIGWSMGGVIAYEMAQQLQA
KNEPVALLTLIDSYAPTLIQMPLEIDQAMIVNQLAQDLGGLYGQELDISHETLRKLEPDE
QVLHLFEQSKQQGILPSDLEIELMRSLWKVLKANITAYYHYKPKAYPGSLLLINASQTSP
GVIEDPTHGWGSLVNGDIQTHTITGDHYTIIKAPQVEALTTELNKYLLNN
NT seq 6093 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatcagcttgcttatatctttctgcaaaacggagaaaccccctcaggaagtctt
acctacggcgaattagacagacaagcaacagcgatcgcatttcatctccaatccatggaa
ggagaacgggctttattgctatacccttctggattagaatttattacagctttctttggc
tgtttgtatgcgggggtaatagctgtgccagtttatcctccaagacgcaatcagaagttg
tctcggttgctaaatatcgttaatgatgctcaagctgatgtagcactgaccaccacatcg
atactggctgacattgagcaaaggtgggctagtgatgcggagttagcgcagttgcagttg
gtagctacagatacaattgttgctaatggtcaagagtttgtacctcaatcagtgacacgg
tcgagtttggcgtttttgcaatatacttccggttctacaggaacacccaaaggggtaatg
gttactcatgggaatctgatccaaaattccacaaacctagatcgcggatgggagcataac
tcggatagtgtaattgtaacttggctcccaacattccatgatatgggactcatatacggg
atgctccaacccatatacaagggatgcaaatgtattatgctgccaccagcgtccttcata
caaaaaccgattcgctggctaaaggcgatttctgattacggagggactcatagtggcgca
cctaattttgcttatgcactgtgtgtcgaaaaaacaactccagaacaaaggaatcagcta
aacctcagtagttggagcatggctcttaatggagcagaacctgttagagccgatgtttta
gagaagtttgcacaagtttttgaagtcagtagattcaacaaaagggctttctgtcccggt
tatggcatggcagaagcaactctaaagatttctgctgtacgcgctaaagataagccgatt
tactatcatattgatgccactgctctagaacaaaattacgttgtagaatttcctgatgag
aaacatttaggaataggaaaacgaactcttgttggttgtgggagaagtgagattgatacc
aaagttatcattgttaatccacaaacctgttgtcgtagtgcttctgaagaaattggggaa
atttgggttagcggtggcagcgtagcttctgggtattggaatcgccccgaagccacacaa
aaaacgtttcaagcttatctcaaagatacaggggatggaccttttttacgtacaggggac
ttaggtttttttagtaagggggaactgtttgttacaggaagactaaaggatctaattatc
attagaggtcgcaatcattatccccaagatattgaattaactgttgaaaacagccatcct
tctctacgaagtcattgtagtgctgccttttctgtagagagggatggagaggaacgcttg
gtggttgctggtgaggtggaacgaactcacctacgcaagctgaacacagaggaggtagtt
agagaaattcaaatagccctatcaacagaacatgaattagacgttgatggggtggttttg
ttgaagacggggagtattcctaagacctctagcggaaagattcaacggcgtgcttgtaag
caaggatttttagaagggagtttgaatgtcgtaggccagtggcagaaaactttatcccag
catgaatacgtagcaccacgcaccccaaccgaagaaataatcgccaacatcttcgcttct
gttctaggagtgaaagatgtaggaatacatgacaacttctttgaaatcggaggacattct
atacttgccactcaattaatttcccaactgcgagtaaccttcaacagagaaataccccta
agacaagtatttgaaagcccgacaatcgctcttatttcgcctaaattaacccaattactg
accacagaaaaccaattaagtcttcctttgattcaaccaagaaccgatagtgaacaatta
cccctatcatcggctcaaaaaagactgtggttcctcaaccaactagaaggaagtagtgcc
acttataacataccagcagcctttagaatcactggcaacttgatcattaacgccctagaa
caagccttatcagaaataatcagtcgtcacgaagtaatacggacaagtttctccactatt
aatggcaaaccaatacaagtaattcaccccgacagcaccattaacatcaatgtggtggac
ttacaacaatacccagaaccagaacgggaaactatcttacagcaacttgtacaacaggaa
gcaacaaccccctttgacctagaagtagcaccattaatccggtgtaaattatggcaacta
gacactaccgagtatgtgttagtgctgaccatgcaccacatagtctctgatggttggtcg
atgggaatattaatcgaagaactatcaagtttatatcaagcttttgcggcatcagaacca
tcccccttacccgaattagcgattcaatatgctgactttgccctttggcaaagacaatgg
ttaactggggaaatcctagaaatccaactcaattactggaaacaggaattagagggtgct
ccagaattattacaactgccaacagaccgttctcgtccccatgtacagagttaccagggg
agtagtgaaagttttagtttaaccgctgaactaacccagaagctgcaacagttgtccagg
aacgcaggtagtaccttatttatgaccctgcaggcagcgtttgccaccttactgtatcgt
tacagtggacaatttgatattttaattggttcaccgatagccaatcgcaaccgccgtgaa
atagagccactaattggcttctttgtcaataccttggtgttgagaactcgttttgaacat
aatcccagtttttcccagttgctcaggcaagttagggaaaccacactcaacgcttatgaa
catcaggatgtaccttttgaacaggtagtcgaagcattgcaaccccaacggtctttgagt
cattcccccctgttccaggtgatgtttgtgctacagaatgcaccgatggggaaattagac
ttaccaggtgtgacattgagtcagttcaatcaacacagtacgattgctaagtttgatttg
accctgtcaatgacggaaacagagatgggattggtggggacatgggaatacaacacagac
ttatttgatgggtcaactattaaaaggatggctactcatttccagaacttgttgtcagca
attgtggaaaatccccaacttagagtgggtgaattccccttattgagtgaaggggaacgc
catcaactgttgctggagtggaatgatactgccagtgaatatcccaaagaaaaatgtatt
catcagttatttgaagagcaggtcgagaaaacacccgatgctatagctgtggtgtttgac
caacagcagttgacttaccatcaattaaatcaaagggcgaaccaattagcacatcaccta
caaaacttaggagtaggaccagaggtactggtaggtatttgtgtggaacgttctgtacag
atggtggtaggactgttggggatactgaaggctggtggtgcttatgtacccctggatcct
aattatcctcaccaacgactgagttatatgttggcggattcgggtgttgaggtgttgttg
actcaacagtcgttactagaatctttgccatcacatacagcacagatggtttgtttggat
agtgattggcgtgccatagagcaatatagtggacagaatcttgatgtcggggtaacttca
gataatttggcttatgtgatttatacctctggttctaccggtaaacctaagggaacaatg
attctccatagtggtgtggggaattatttaagctggtgtacaaaagcttataatgttgcc
gattcagaaggctctactgttaattcttctattggcttcgatgccactattaccagttta
ttttctcctttgttggtaggacgtaaggtagttcttttaccagaggaaggagaaattgaa
gcccttaaagccgccttgtgttctgggactaagtttagcctggttaaaatcactccggct
catttagaaatcctcagctatttattggctcatgagcaagtcacaattgagaataaagcc
tttataattggtggggaagctttgtcagcaaaccacattaaattctggcaaaaatacgct
cctcagattagattaattaacgaatacggtcccacagaaactgttgtaggatgctgcatt
tatgaagttggaggaaaaaccttttctggagggaatattcccatcggtcgccccatagcc
aacacccaaatttatatcttagacaaacacctgcaaccagtaccgataggagtacccgga
gaactctacatcggaggtgatggcttagccagaggatacctcaagcgcccagaactaaca
tcggaaaaattcatacataatcccttctgtaattccaaatcacaacgactctacaaaaca
tcagacctggcgagatacctacgagacggtaacatcgaatttctcggacgtatcgataac
caagtcaaaattcgaggcttccgtatcgaactaggggaaatcgaagcagtcctgtccagc
cacccccacatccaacaaaccgtagttattgcccgagaagatattcctggtaacaaacgc
ctagtcgcctacatagtcagtcagtccgaatcactaagcaccaaccaactacgtgaattc
cttaaacagaaactgccagaatacatggtgcccagtgccttcgttaccctagacaccttg
ccgttaacaccaaacggcaaagtagaccgcaaatcactacctgcaccagatggggttgtc
acatcagttgaggaatatgtagctccacgcacccctactgaagaaataatcgccaacatc
ttcgcgaatgttctaggactgcaagatgttggaatacatgacaacttctttgaattagga
ggacattctctactggctgtccgtttaatgtcccagattaaacaacaattccaaatcaat
ttacctttagcaacccttttccaaagtcccaccattgaacaactagcgagccttctgggt
tcttcagtaaatacacaaaaccccatcttagtgggcattaaaaccagtggaaaccaacct
ccattattctgtattcacccggttggtggcaatctcctgtgttatgcagagttagctcgt
catttagatcaagattatccagtatatggtttacaatctctaggtttagatgggcaacag
caacccttaacttctgttgaggagatggcatcccattatattcaagcaatacagcaaatt
caaccccaaggttcctatcatctcatcggctggtcttttggaggtgtaattgcctatgag
atggcacaacaattacagactaaaaatacttcagtggctcttctaacgttaatagacagt
tatgtacccactttaattcggaaaccttcagaaatagatcaagccatgatagtaaatcta
ttcattggctggtctatgggaggtgtaattgcctatgaaatggcacaacaattacaggct
aaaaatgagccagtggctcttctaacgttaatagacagttatgcacctactttaattcag
atgcctttagaaatagatcaagccatgatagtaaatcaattggctcaagatttgggaggt
ctctatggtcaagagttagatatatcccatgaaacactcagaaaactcgaaccagacgaa
caagttttgcatctatttgagcaaagcaaacagcaagggatattgccatcagacctagaa
atagagctaatgcgttctttatggaaagttttgaaagcaaatattacggcatattatcat
tataaaccaaaagcttatccaggttcacttctccttataaatgctagtcaaacttcccca
ggagtaattgaagacccaacccacggctggggttctctagttaatggtgacatccaaact
cacactattactggagaccattacaccattatcaaagccccccaagttgaggctctgact
acagaattgaacaagtatctattgaacaactag

DBGET integrated database retrieval system