KEGG   Methylovulum psychrotolerans: CEK71_01120Help
Entry
CEK71_01120       CDS       T04929                                 

Definition
(GenBank) non-ribosomal peptide synthetase
Organism
mpsy  Methylovulum psychrotolerans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
236245..246396
Genome map
AA seq 3383 aa AA seqDB search
MRFIEESGLAANPQTTYANFVELARGRASEQPDKTAYVFLQDGENESGRFTFAELDYRAR
TIAAHLQLMGMTGERALLLYPPGLDYIAGFFGCLYAGVVAIPCSPPTRRQKSRLWAVIND
ATPAIIMSTSDFAAKIRNELEEWPECLSSNKEPNLLGDDKSKPGLTWFASDKLESDITRN
WLPQALGSNSLAFLQYTSGSTGNPKGVMVSHGNLMANQKAIKQGFGHTDQTTVVGWLPLY
HDMGLIGNLLQPLYLGATAILMPPMAFLEKPIRWLKAISFYRASTSGGPNFAYDLCLRKV
TAEQMQSLDLSSWRLAFNGSEPVRSATMERFAEKFADCGFRRANFFPCYGLAEATLFVSG
EKLSATENVMCADAGQPASAVACGLVSEHHEIRIVDPATGQLCPTGHVGEVWVSGPSIAK
GYWNRQEESEQIFRMPISDASVNTAQTFLRTGDLGYLNNSRLFITGRIKDLIIIRGRNFY
PQDIEQVLVEEIPELIPDACATFSKSDGDEEQLVVVAEITRTAIRSDSYLMIAAAMRKSL
AETCGLAITELALVQPGTVPKTSSGKLRRQPCKQMYMENALPILFRSGAQADVDSSSAGE
SGGQVNEAEARATLSPESQILQQALAVVPKAQRVALIARFLCQKTALLLKIEASTLTTDV
PLRSLGLDSLKAVELKYTTDELLGTDVPLSLFLSDYSLQTIAEKLSETATDTTAGIAATQ
NTATHGTLYTSGLSAGQSSMWAMQQLGGASGVMTKPDSIVYNLHLALRINGSIDLERLKQ
AFRHLLERHTLLRTVYRADDNGHISQQVLPLSGLADFFTSVEACSWSQTQLQADMTHRVR
VAFDLENEALLRTVCYLHGKSNPDHTDPVSAGETYTLLICAHHIAVDLWSVLILVKELQA
IYAGKERQLNALKSNYADFVAWQRHYLDGPACGKAWDYWHQQLQGELPLLALPTDKPRPA
VSDYQGASVAFTLDSEISEQLKRLAGQQGVTLFALLLTAYKVLLHRHTHQEDIIVGVPSS
GRSQARFTQIVGNFVNPLPLRSSPNGNKPFLTYLTEVNEALLNALAHQDLPFPLMVERLQ
PERVADHWPIYQTMFVLQQVQADFDKHLAQLSLGEDGDFSDWGVMQARPLALQQRVENFD
FKLMAAQCHNGFQFSFQYRSDLFEAATIAAWAQRFQQLLMGIANDCTAKLKDLPLLTENE
RHSLTVAWNATATVYSGADSIHRLFEAQVDKTPEQIALVYQDRQLSYLELDALSNRLANA
LIAAKLAINIPIGICAQRSLAMVVGLLGILKAGHAYLPLDPDYPHERLSAMLADADTPVI
LVQPEFAGIFADFNGKLYSLDVGLTDFGGFSEQRPTSPVDSEALAYVLFTSGSTGRPKGV
GVPHKGVRNRLLWMQAYFGLDVGDAVLQKTPYTFDVSVWEFFWPLITGARLVMAPPGDHK
DPARLVDLIERHGITTLHFVPSMLAAFLNMADFDRCGSLRRVICSGEALTADLQNRFYGH
AKAGLFNLYGPTEASIDVTVWNCQRDTSEHLVPIGHAIANTQIYLLDKYLNPVPVGVAGE
LYIGGVQLARGYVNQAGLTAERFVPNPFSTAGGRLYRTGDLACYRQDGNIDYLGRIDHQV
KMRGFRIELGEIEAVLLQNTMVRDAVVVVREEGPSDKYLAAYWVAKQTSVSDKEALQRFL
QERLPDYMVPTILIELDNLPVTDNGKLDRKALPVPNLSAQFAGHYLAPSNETETVLAQIW
ADLLKVERVGIHDNFFALGGDSILAIQAAGRARQAGLAFMPRHLFELQTIAKLAETISQD
QTHSLAQDNSYGNVPLTPIQHWFFEQNFANPNYWNQALLLTMKTPLAVPLLEKAFDYLVS
QHDALKFRFSQENKVWHQESLPHLAHSVFRRVDMAGIPDADKANVMLAECGRSQASLDLK
AGVLLRAVWFDYGDHQHSRLFIVIHHLVVDGVSWRILLADLQSIYVQLAESKTVVLPAKT
TSFKHWAEQLRLFAQGGELQNEADYWLTITAADTPVLPLDYPDGSRLEGVVANCIESLDE
TGTQALLGDALLTYRTGVDELLQVALAQTLCEWCEGESVVFDREGHGREDLFDNLDLSLT
AGWFTSLYPVRLQLPKDASISQTIKSIKTQLAHIPRKGIGYGVLRYADLPAISAKLASAP
KAQVLFNYLGRFDEAFTNAPWQLAPETPDAFRGSNNTSVYELEINAYVSQGRLYTQWRYS
TERYRTATVAGLAKRFIEHLQKLLDHCLSAEVAGFMPSDFPLADLDQDALDALPYTASEI
EDIYRLSPMQEGMLFDTLMAPNSGIYLMQDRFEMHGVIDENLFQRAWQMIIDRHSALRNG
FLWETTPHPVQIVHRHVNVPFEFHDWRSLPPDEQHSRLEDILAAERWQSFDFLKPPLMAI
RLIQLAKGRYCFVRSYHHILIDAWCMSLMLVELMANYKALSSGQPQPQPQPPQFRSYIAW
LQKRDTETAKQFWQHYLSGITEATPFNVDRLLPSTDTGTLGVADAIMLLSAKNTKQLAAM
AQHHRVTPNTFVQAAWAVLLSHYSGCTEVVFGVTVSGRPAELAGSEDMLGVFINTLPLRV
AIDTTLSVSEFLSLLLQQNIELRQYEYTQLVQIQNWTGMGREQPLFESLLVFENYPVDPS
LRTNANPLHIVDVATRTHTNYPLNGMVIPGEQLHLQITYHKNRFETAVVERMLGHFKNLL
EAMIANPGQRLGEISLLAQTERQLMLQHWNQTAHAYPEPCDMVSRFEWQAEHKPDAIAVA
CSGKQLTYTELNQRANRVAYALMSEGAEPETLVALFGERGIDYLVMMLGAFKAGMAYLPL
DPSHPDSRIAQVLEESGTLWILTCTAHFERVSALADIAGGTPAMQKPASLNLQLLSRPDV
LVLEDLELYETSLENPPKLHHPDNLAFVIFTSGSTGTPKGAMVEYKGMFNNLITKVPTLN
LTERDVIAQTAGQCFDISVWQHLTALVCGARVEIFPDDIVKEPYLLLAKLAERGVTVLEA
VPSMLQALLDSADYTVALPKLRWLIACGEAFPPEVCRRWMEWMPHVKVLNAYGPAECSDD
VSYYHVPGIPGETETIVPIGRPVHNTQLYLLNQWLEPVPVGVPGEICVAGIQVGRGYLER
ADLTAEKFIPNPFIFAQDGLGDEVGGRLYRTGDLGRYREDGAIEFLGRIDHQIKVRGVRI
EPGEIEAQLLSFADIEQALVTVREDGVGEKRLVAYVVCNKSLANSDAELFAKLRGHLAAR
LPDAMMPQAFVRLDAMPLGGTGKIDRKALPMPDMAGQSDRAYVAPRNPTEQALATIWKEV
LAIDKVGVADNFFDLGGHSLLAVQVLSRLRRAFGIEVPLRRLFEASTIEALALLVETLLI
EQLASLSEEEAEALLLEEEQDLR
NT seq 10152 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcttcatcgaagaatcaggactggctgcgaacccccaaacaacttacgccaatttt
gtagaattggcccgtgggcgggcgagtgaacagcccgataagacggcctacgttttttta
caggacggcgaaaatgaaagcggtcgcttcacctttgccgaattggactatcgcgcccgc
actatcgccgcccatcttcagcttatgggcatgaccggtgaacgggctttgttgctctat
ccgccggggcttgattatattgcgggttttttcggttgtttgtatgccggtgtggttgcc
ataccttgcagtccgcctacacggcggcaaaagtcacggctttgggcggtgattaacgat
gccacgcccgccattatcatgagcacctctgattttgcggcgaaaatccgcaatgaattg
gaggaatggcctgaatgtttaagttcaaataaagaacccaacctgttaggagatgacaag
agcaaaccaggcttgacatggtttgccagcgacaagttggaatccgacattaccagaaat
tggctaccacaggcattaggttccaatagcttggcttttttgcaatacacatccggttcc
actggaaatcctaaaggagtgatggttagtcacggtaatctaatggctaatcagaaagcg
ataaaacagggttttggacataccgaccaaaccaccgttgtcggttggctacctctgtat
cacgatatgggcttgatcggcaacctgttacaaccgctttatcttggtgccacggcaatt
ttaatgccgcctatggcatttctggaaaaacctatccgttggcttaaagccatttcattc
tatcgggcaagcacatcgggcgggccgaattttgcttatgacctttgtctgcgtaaagtg
acggcagagcagatgcaatccttggatttgagtagttggcgtttagccttcaacggttca
gagccggtacgcagtgccaccatggagcgctttgcagaaaaatttgccgattgtggtttt
cgccgcgccaactttttcccttgctatggcttggctgaagcgacgctttttgtgtcaggg
gaaaaactgtccgctacggaaaatgttatgtgtgccgatgcgggtcagcccgcaagtgca
gtggcttgtggcttagtctctgagcatcacgaaatccgtattgttgatcccgcaacaggc
caactatgcccaacaggacacgtcggtgaagtttgggtgtccgggcctagtatagccaaa
ggctattggaaccgtcaggaagaatcggaacagatttttcggatgcctataagcgatgca
agcgtcaacaccgcgcaaacttttcttcgcactggcgacttgggataccttaataatagc
cgcctgttcataacaggccgtatcaaagacttaatcatcatccggggacggaatttttat
ccgcaggatattgaacaagtgctggtggaagaaatccctgaacttattcccgatgcctgc
gccaccttttcgaaaagcgacggtgacgaagagcaattagttgtagttgccgaaataacc
cgtaccgcgatacgctcagatagctatctgatgattgccgccgccatgcgtaaaagcttg
gccgaaacctgtgggctggcgatcaccgaattggctttggtacaaccaggtacggtgccg
aaaacatccagcggtaagcttcgccgtcaaccctgcaagcaaatgtacatggaaaacgcc
ttgccgatcttattccgttccggtgctcaagcggacgtggatagttccagtgccggagaa
tctggcggacaagtcaacgaagcggaggcgcgagccacgctgtcaccagaatcccaaatc
ctgcaacaggcgttggcggttgtcccaaaggcacagcgcgtggcgttaatcgcccgtttt
ctctgccaaaaaaccgcgcttttgttgaaaattgaagcatcaaccctaaccaccgatgtt
cccctgcgctcgttggggctggattcgctcaaagccgttgaacttaagtatacgaccgac
gaattgctaggtactgatgtgccgttatcgttgtttttgtccgattattcgttgcaaaca
atagctgaaaaactctccgaaaccgccacagacaccacagcaggcattgccgccacccaa
aataccgccactcatggcacgctttacacttcgggcctgtctgcgggtcaatcctccatg
tgggcgatgcagcagttagggggggcttccggtgtaatgacaaagccggatagtattgtc
tataacctgcatttggccttacgcattaatggcagtattgatctggaacgcttaaagcaa
gcctttcggcatttgctggaacgccataccctattacgcactgtataccgcgctgatgac
aatgggcatattagccaacaagtgctacccctatctggattagcggatttttttacctcc
gttgaagcctgttcatggtcacaaacccaattgcaagccgatatgacccatcgggttagg
gtggctttcgatttggaaaacgaggcgttactgcgtaccgtttgttatctgcatggaaaa
tcgaacccagatcataccgatccggtatctgctggagaaacctatacgctgttgatttgc
gcccatcatatcgccgtcgatttgtggtcggtgcttatcctggtcaaagaattgcaagcc
atctatgcaggtaaggaaaggcaattaaacgcgctcaagtccaactatgccgattttgtt
gcttggcaaaggcattacttggatggtccggcctgcggtaaggcttgggattattggcat
cagcaattgcaaggggaacttcctttgctggctttgccaaccgataagccaagaccggcg
gtgtcagattatcagggcgcttcggtggcattcaccttagatagcgagatcagcgaacaa
ctgaaaagactggccggacagcagggggtaaccctgtttgccttattgctcaccgcatac
aaggtgttgttgcatcggcatacccatcaggaagatattattgtcggtgttcctagcagc
ggacgtagccaagcgcggtttacccagatcgttgggaatttcgtcaacccgttaccactg
cgcagtagccctaacggcaacaagccgtttttaacctatttgacggaagtcaacgaggct
ttactaaacgcgttggcacatcaggatttgcctttccccttgatggtggagcggctacaa
cccgaacgcgttgccgatcattggccgatttaccagactatgtttgtattgcaacaagtc
caggccgattttgataagcatttggctcagttaagcttgggggaggatggcgacttttca
gattggggagtcatgcaagcgcgaccattggcactacagcaacgggtcgagaattttgat
tttaagctcatggccgcacaatgccacaatgggtttcagttttccttccagtatcgcagt
gacttgtttgaggccgcgaccattgccgcttgggcgcagcgtttccaacaattgcttatg
ggtattgccaatgactgtaccgccaaactgaaagatttgccgttgcttactgagaacgag
cggcatagcctgaccgttgcctggaatgctacggcaaccgtttattcgggagcagacagc
atccatcgcttgtttgaagcgcaagtagacaaaaccccggagcaaatagctctcgtttat
caagaccggcaacttagctacctagagctggacgcgcttagcaatcgcttggccaatgcc
ctgatagcagcaaaactggccatcaatatccctatcggtatttgcgcccaacgctcattg
gcaatggtggtggggttactgggtatattgaaggcaggccatgcttatttgccgcttgat
cctgattatccacatgaacgcctgtcggcgatgttggctgatgccgacacgccggtgatt
ttggttcaaccggaatttgccggaatatttgcggattttaacggcaaattgtatagcctt
gatgttggcttgacagattttggcggtttttccgaacaaaggccgactagcccagttgat
agtgaagcgctggcttatgtgttgttcacttccggttctacgggacggcctaagggtgtg
ggtgtgccgcataaaggggtgcgtaaccgtctgctatggatgcaggcctacttcggctta
gatgtgggcgatgctgtgctgcaaaaaaccccttacactttcgatgtctcagtatgggaa
tttttctggccgttaataaccggtgcgcggttggtcatggcgcctccaggcgaccataaa
gaccctgcacggttagttgacctgattgaacggcacggtatcactactctgcattttgtg
ccgtcgatgctggcggccttccttaacatggctgattttgaccgttgcggatctttgcgg
cgcgtcatttgtagtggtgaggcgttgactgccgatttacaaaatcgcttttacggacat
gcaaaagctgggcttttcaatctatatgggccgaccgaagcgtctattgatgttacggtg
tggaattgccaacgtgacacttccgagcatctggtacccatcggccatgctatcgccaac
actcaaatctatcttttggataagtatctgaatccagtaccggtcggggttgcaggtgag
ctttacatcggcggcgtacaattggcccgcggatatgtaaaccaagcaggactgactgcc
gaacggtttgtacccaatcccttttctacagcgggcgggcgcctatatcgtactggcgat
ctggcttgctatcgtcaggatggcaatatcgattatttgggccggattgaccaccaagtg
aaaatgcgtggttttcggattgaattgggtgaaatcgaagccgtattgttacaaaacact
atggtcagagatgctgtcgtagttgtccgcgaagagggccctagcgataaatatttggcg
gcttattgggtggccaaacaaacatccgtatcggacaaggaagcgttacaacgctttctg
caagagcgcttgcccgattatatggttccgaccattttgatagaactggacaaccttcca
gtgacggataacggcaaactggatcgtaaagccttgccagtaccaaaccttagtgcccaa
tttgccggacattacctagcgccaagcaatgaaacagaaacggtattagcgcagatatgg
gctgatttgttaaaagtcgaacgggtcggcatccacgacaatttttttgccttgggtgga
gattccattttggctatccaagccgctggccgggcgcggcaagccggactggcctttatg
ccccgccatctttttgaacttcaaactatcgccaagttggcggaaacgataagccaagac
caaacccatagcttggctcaggataacagctatggcaacgtgccattgacacctatccaa
cattggtttttcgaacaaaatttcgccaatcccaattattggaaccaagcgttgctattg
acaatgaaaacgcctttggctgtgccattattggaaaaagcctttgattatctggtttct
caacatgatgcgttaaagtttcgcttcagccaagaaaataaggtttggcatcaggaaagt
ttgccccatttggcgcattctgtattccgacgtgtggatatggctggtattcctgatgcg
gataaagccaatgttatgcttgccgaatgcggacgtagccaagccagcttagatttaaag
gccggtgtcctattgcgggcggtatggttcgactatggcgaccaccaacactcccgtctg
tttatcgttatccatcatttggtggtggatggggtctcctggcgcattttattggcggat
ttacaaagcatttatgttcagcttgccgagtcaaaaaccgtggtgttgcccgccaaaacc
acatcattcaaacactgggccgaacagcttaggctatttgcccaaggcggggagttgcaa
aatgaagccgattattggctaactatcaccgctgcggatacccctgtcttgccgttagac
tatcctgacggttcacgccttgaaggcgttgttgccaactgtattgagtcgctagatgaa
acgggcacccaggcattactgggtgacgcactattaacctaccgcacgggcgttgatgag
ttgttgcaggtcgccttggcacaaaccctatgcgagtggtgcgagggcgaaagcgtggtt
tttgaccgtgaaggccacgggcgggaagacttgtttgacaaccttgacctgtcacttacg
gcaggttggttcaccagcttatatccagtccggctccagttgcccaaagatgccagcatc
agtcaaaccatcaaatccataaagacgcaattggcgcatatcccccgtaaaggcattggt
tacggcgtgttgcgttatgccgatttgcccgccatttcggcaaaactggcctctgcgcct
aaagcacaagtgctgttcaattatcttggccgcttcgacgaagccttcaccaatgcccct
tggcaactcgcccctgaaacaccggacgcgtttaggggctccaataacaccagcgtttat
gaattggaaatcaatgcctatgtgagccaagggcggctctatacgcaatggcgatacagc
accgaacgttatcggacagcaacggtagcgggtttggccaaacgttttatcgaacattta
caaaaattgcttgaccattgccttagcgcagaagtggccggatttatgccatccgatttt
cctctggcggacttggatcaggacgcgcttgatgcgttgccgtatacggcctcagaaatc
gaagacatctacaggctttcgcccatgcaggaaggtatgcttttcgataccttgatggct
cccaattcaggcatttatctgatgcaggatcggtttgagatgcacggggtgatagacgaa
aatctgttccaacgcgcttggcaaatgatcattgaccgtcatagtgccttacgcaacggc
tttctgtgggaaaccacccctcatcccgtgcagattgtacatcgccatgtcaatgtgcct
tttgaatttcacgattggcggtcgttgcctcctgacgaacagcatagccgattggaagac
atcctggcggcggaacggtggcaaagttttgatttccttaagccgcctttaatggctatc
cgtttaatacagttagcgaaagggcgttactgttttgtcagaagttaccatcatattttg
attgatgcttggtgtatgtcgttgatgttggttgaattgatggctaactataaggcctta
tccagtggtcagccccagccccaaccacaaccgccgcaatttcgcagttacatcgcttgg
ctgcaaaaacgcgataccgaaaccgccaaacaattttggcaacattatttgtccgggatt
actgaagcgacaccgtttaatgtcgataggcttttgccctctacagatacgggcacgctg
ggtgtcgccgatgcgattatgttactgtcggcgaaaaataccaagcagttggccgcaatg
gcccaacaccatagggtcacgcccaacacttttgtgcaggcggcttgggcagtgctgctg
agccactatagcggatgcacggaagttgtgtttggcgtgaccgtctcaggacggcccgcc
gaattggcgggcagtgaagacatgctgggggtgttcatcaacaccctaccgttacgggtc
gccatcgacacgacgctgtcggtatcggaattcttaagcctgttattacagcaaaatatc
gaattacggcagtatgaatatacacagctggtgcaaatacaaaactggactggaatgggg
cgcgaacaacccttattcgaaagcttattggtatttgaaaattaccctgttgaccccagt
ctgcgtacaaacgcaaacccgttgcacatagtggatgtggcgacccgtacccataccaat
tacccgctcaacggcatggttatccctggcgaacaattgcatctgcaaatcacctaccat
aaaaacaggtttgaaacggcagtcgtagagcggatgctgggacatttcaaaaatctgctg
gaggccatgatcgctaatccaggccaacggctgggtgaaatctccctgctggcacaaaca
gaacgccagttaatgctgcaacactggaatcagacggcacacgcctacccagaaccttgc
gatatggtcagccgttttgagtggcaagccgaacacaaacccgatgccattgcagtcgcc
tgttccggcaagcaactgacttatacagaactcaaccagcgtgccaaccgcgtcgcctac
gcattgatgtccgagggcgctgagccagagacgctagtcgcgttatttggcgagcgcggc
attgattatctggtcatgatgctgggtgcgttcaaagcaggcatggcttacctgccctta
gaccctagccatccagatagcaggatcgcccaagtgttggaagaaagcggcaccttgtgg
atattgacttgcacggcacattttgaacgcgtatcggcattggcggacatcgcagggggg
acaccagcgatgcaaaagcctgcgtcattaaatctccagttgctgtcacgccccgatgtc
cttgttttggaagacttggaattatatgaaaccagtttggaaaacccgcccaagcttcat
caccctgacaatttggccttcgttatttttacatccggttctaccggcacccctaaaggg
gcgatggttgaatataaagggatgttcaataacctaatcaccaaagtgccgaccctgaac
ttaacggaacgggatgtcattgcgcaaacggcggggcagtgtttcgacatttctgtttgg
cagcacctgaccgctttggtctgtggggcgcgggtcgaaatctttcctgacgacattgtc
aaagaaccttacctcttgctggcgaaattggccgaacgcggcgttactgtgttggaagcg
gtgccgtccatgcttcaagccctgttggacagtgctgactataccgttgcattgcctaaa
ttgcgctggctgattgcctgtggcgaagccttcccgccggaagtctgccgccgttggatg
gagtggatgcctcatgtcaaggtactcaacgcctatggcccggcggaatgttcggatgac
gtgtcgtattaccacgttccgggcatacctggcgaaactgaaaccatcgtacctataggc
cggcccgtacataacacacagttgtatctactgaaccaatggttagaacctgtccctgtc
ggcgtacctggggaaatttgtgtggccggtatccaagtcgggcgcggttatcttgagcgg
gcagatttgactgccgaaaaatttatcccaaatccctttatctttgcccaagacgggctt
ggtgatgaagtgggcggacggttgtaccgcaccggtgatttaggccgctatcgtgaggac
ggtgctatcgaattcctaggacgtatcgatcatcagatcaaagtccgtggggttcgcatc
gaaccgggtgaaatcgaagcacagcttctgtcttttgccgatattgaacaagccttagtt
accgtccgagaagatggagtgggggaaaaacgcttagtggcttatgtggtatgtaacaaa
tcgcttgccaatagcgatgctgaattattcgcaaaattgcgcggccacttagcggctaga
ttgcccgatgcaatgatgccgcaggcttttgtccgacttgatgccatgccgcttggcgga
actggcaagattgaccgtaaggccttgccgatgccggacatggcaggacaaagcgaccgc
gcttatgttgccccgcgtaatcccaccgaacaagcgcttgccactatttggaaagaggtg
ctggctatagacaaagttggcgtggcggataactttttcgatctgggtggacattcgttg
ttggcggtgcaagtgttgtcacggttacggcgggcttttggcattgaagtaccgttacgc
aggcttttcgaggcctccactatcgaagcgttggcattgttggttgaaacgctgctgata
gagcaattggccagcctgtctgaagaagaggcggaggcgttattgcttgaagaggaacag
gacttaaggtag

DBGET integrated database retrieval system