KEGG   Marichromatium purpuratum: MARPU_09415Help
Entry
MARPU_09415       CDS       T03650                                 

Definition
(GenBank) 1-acyl-sn-glycerol-3-phosphate acyltransferase
Organism
mpur  Marichromatium purpuratum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2109113..2111902)
Genome map
AA seq 929 aa AA seqDB search
MPGARTPMSDPADPLLALVRAFARDSRLAIAPETIGPDTRLETDLGLDSLGRAELNARIE
QGLGIELPERALLAATVAELRALARARGATGTEPGPRPVPAVDAHAGVPEQAATLLEVLD
WHCERHGERVHIHWYDAEDRVHPIRYRELAEGAARVANRLHGAGVCAGETVALMLPSGPG
YFFSFFGVLRAGAVPVPIYPPARPQLIEDHLRRHARILANAGCVAMLTEGAAARVATLLR
LQLPALGAVLTLDGLERESCAFEAPAAAPDDLAFLQYTSGSTGAPKGVRLSHAELLANIR
AMGEAVAITPEDRFVSWLPLYHDMGLIGAWLGSLYFAIPLVSLSPLAFLARPRRWLQAIA
DHRATLSAAPNFAYELCLSRIGEQQLAGLDLGSWRRAFNGAEPVSAETLERFAARFARYG
LRPEALAPVYGLAEAAVGLCFPPPSRGPRIDCIDRERLAESGYALRVDCDDPGAQRVVGC
GRPLPGYRLRVVDARRAPLPERHEGLVQFQGPSATRGYYRNPEASAALIREGWHETGDRG
YLADGEIHLTGRVKDLIIRGGRNLYPYELEQAIGALRGVRQGCVVAFAARDPGQGSERLV
VVAETKERDPGRRALLRQRILACAGEVLGAPPDEIVLAPPRAVLKTSSGKLRRGDTRARY
LAGRIQTTPAAPWWQLVRATLAGLRGRMLADTGTLPRYLYAVHVWLMLALIAPPCWLAVA
LLPGHRLRWAVVRGAAGVLRRLVGVRLAVAGRERLPPPGAPWVLVANHQSYVDALVLAEA
IGRPLCFVAKRELGRNRLAAHFLQRLDCVLVDRFDVRAGGAALAELRARLAAGCPLALFP
EATFRVRPGLLPFRMGAFSLAAEARAPLVPVALEGTRALLAGARLFSPRRGRVRVYIGPA
LIPGGADWGAAVALREQAREWIESRVAGG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
gtgccaggagcgagaacccccatgtccgatcccgccgatccgctgctggcgctggtgcgc
gccttcgctcgcgattcgcgcctggccatcgcccccgagaccatcggccccgacacccgg
ctcgagaccgatctcggactcgacagcctcggtcgcgccgaactcaatgcccgtatcgag
cagggactcgggatcgagttgcccgagcgcgcgctgctcgccgccaccgtcgccgagctg
cgggcgctggcgcgcgcgcgcggcgcgacggggacggagccgggtccgcgcccggtcccc
gctgtcgacgcccacgccggtgtcccggagcaggccgccaccctgctcgaggtgctcgac
tggcactgcgagcgccacggcgagcgggtgcacatccactggtacgacgccgaggaccgc
gtccatccgatccgctatcgcgagcttgccgagggcgcggcgcgggtggccaaccggctg
cacggcgccggggtgtgcgccggcgagacggtggcgctgatgctgccgagcgggccgggc
tatttcttcagcttcttcggcgtgctgcgcgccggcgctgtgccggtgccgatctacccg
ccggcgcgcccccagctcatcgaggaccacctgcgccggcatgcccgtatcctcgccaac
gccggctgcgtggcgatgctcaccgagggcgcggcggcgcgggtcgcgacgctgctgcgg
ttgcagctgccggcgctcggcgcggtgctcaccctcgacgggctcgagcgcgaatcgtgc
gcgttcgaggcgccggcggccgcacccgacgaccttgccttcctgcaatacacctccggc
agcaccggcgcgcccaagggggtgaggctcagccacgccgagctgctggccaacatccgc
gccatgggtgaggcggtggcgatcacccccgaggaccgcttcgtcagctggttgccgctc
tatcacgacatggggctgatcggcgcctggctcggcagcctctacttcgccatcccgctg
gtctcgctctcgccgctggctttcctcgcccggccccggcgctggttgcaggcgatcgcc
gaccatcgcgccaccctctcggcggcgcccaacttcgcctacgaactctgtctcagccgc
atcggcgagcagcagctcgccgggctcgacctcggcagctggcgccgcgccttcaacggc
gccgagccggtgagcgccgagaccctggagcgtttcgccgcgcgcttcgcccgctacggg
ctgcgcccggaggcgctcgccccggtctatgggctggccgaggcggcggtggggctgtgc
ttcccaccgccgagccgggggccgcggatcgactgcatcgaccgcgagcgcctcgccgag
agcggttatgcgctgcgcgtcgactgtgatgaccccggcgcgcagcgcgtggtcggctgc
ggccgaccgctgccgggctatcggctgcgggtggtcgatgcccggcgcgcgccgctgccc
gagcgtcacgaggggttggtgcagttccaggggccttcggccacccggggctattaccgc
aaccccgaggcgagcgccgcgctgattcgcgagggctggcacgagaccggcgatcgcggc
tatctcgccgacggcgagatccatctcaccggccgggtcaaggacctgatcatccgcggc
gggcgcaacctctatccctatgagctggagcaggccatcggtgccttgcgcggggtgcgc
cagggctgcgtggtggccttcgccgcgcgcgatccggggcagggcagcgagcgcctggtg
gtggtcgccgagaccaaggagcgcgaccctgggcggcgtgcgctgctgcgccagcgcatc
ctcgcgtgcgccggtgaggtgctgggtgcgccgccggacgagatcgtgctcgcgccgccg
cgcgcggtgctcaagacctccagcggcaagctgcggcgcggcgatacccgtgcgcgctat
ctcgccgggcgcatccagacgacgccggccgcaccctggtggcagctcgtgcgggccacc
ctcgccgggctgcgcggacggatgctggccgacaccggcacgctgccgcggtatctctac
gccgtccatgtctggctgatgctggcgctgatcgcgccgccgtgctggctggcggtggcg
ctgctgccggggcaccgactgcgttgggcggtggtgcgaggtgctgccggggtgctgcgt
cggctcgtcggcgtgcgcctggcggtcgcggggcgcgagcggctgccgccgccgggcgcg
ccctgggtgctggtggccaaccaccagagctatgtcgacgccctggtgctggccgaggcg
atcggccgaccgctgtgcttcgtcgccaagcgcgagctgggacgcaaccggctcgccgcc
catttcctgcagcggctcgactgcgtgctggtcgatcgcttcgacgtgcgcgccggcggc
gcggcgctcgccgagctgcgcgcgcggctcgccgccgggtgtccgctggcgctctttccc
gaggcgaccttccgcgtccgccccggcctgctgcccttccgcatgggcgccttctccctc
gccgccgaggcgcgggcgccgctggtgccggtggcgctcgagggtacccgcgcgctgctt
gccggcgcccgccttttctcaccgcgacgcgggcgggtgagggtgtatattgggccggcg
ctgattcccgggggcgccgattggggcgcggcggtggcgttgcgcgagcaggcgcgagag
tggatcgagagccgggtggcgggcggttga

DBGET integrated database retrieval system