KEGG   Meiothermus ruber DSM 1279: Mrub_0978Help
Entry
Mrub_0978         CDS       T01193                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mrub_0978
   00620 Pyruvate metabolism
    Mrub_0978
   00630 Glyoxylate and dicarboxylate metabolism
    Mrub_0978
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mrub_0978
   00680 Methane metabolism
    Mrub_0978
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Mrub_0978
Enzymes [BR:mrb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Mrub_0978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(966301..967290)
Genome map
AA seq 329 aa AA seqDB search
MKPPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEITPALKALGGVIMELEDC
AFPTLAGIVATDDPNIAFGDADYALLVGAMPRKQGMERADLLQANGAIFTAQGRALSENA
RKHVKVLVVGNPANTNALITYKNAPNLSPRQIHAMTRLDHNRAISQLAARLKVPVSEIKK
MTIWGNHSLTQYPDLFHCEVGGRNAYELVGDHDWYANTYIPKVAKRGAEIIEARGASSAA
SAASAAIDHMRDWALGTPAGDWVSMAIPSDGSYGIPEGLVYSYPCVCKDGDFEIVQGLEI
NEFSRSKMDASAKELADERDAVLQLGLIK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccccctgtacgtgtggcagttaccggtgcagccggtcagattggctatagtctg
ctgttccgcattgctgcgggtgagatgctgggcaaagaccagccggtgattctgcaactg
ctggagatcaccccggccctcaaggccctgggcggggtgattatggagctcgaggactgc
gccttccccaccctggccggcatcgttgccaccgacgaccccaacatcgctttcggcgat
gccgattacgctttactggtcggggccatgccccgcaagcaaggcatggagcgcgccgat
ttgctccaggccaacggcgccatctttaccgcccagggccgggccctctccgagaacgcc
cgcaagcacgtcaaggtgctggtggtgggcaaccccgccaacaccaacgccctcatcacc
tacaaaaacgcccccaacctctcgccgcgccagatccacgccatgacccgcctcgaccac
aaccgggccatctcccagctcgccgcccggcttaaggtaccggtcagcgagatcaagaag
atgaccatctggggcaaccactccctcacccagtaccccgacctattccactgcgaggtg
ggcgggcgaaacgcctacgagctggtaggcgaccacgactggtacgccaacacctacatc
cccaaagtggccaagcgcggcgcggagattatcgaggcccgcggggcttcctcggcggcc
tcggcggccagtgcggccattgaccacatgcgcgactgggccctgggcaccccggcgggc
gactgggtgagcatggccatcccctccgacggttcgtatggcattcccgaggggctggtg
tacagctacccctgcgtctgcaaagacggcgactttgaaatcgtgcagggcctggagatc
aacgagttcagccgcagcaagatggacgccagcgccaaagagctggccgacgagcgcgac
gcggtgttgcagttggggctcatcaagtaa

DBGET integrated database retrieval system