KEGG   Meiothermus ruber DSM 1279: K649_04530Help
Entry
K649_04530        CDS       T02636                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
mre  Meiothermus ruber DSM 1279
Pathway
mre00020  Citrate cycle (TCA cycle)
mre00270  Cysteine and methionine metabolism
mre00620  Pyruvate metabolism
mre00630  Glyoxylate and dicarboxylate metabolism
mre00680  Methane metabolism
mre00710  Carbon fixation in photosynthetic organisms
mre01100  Metabolic pathways
mre01110  Biosynthesis of secondary metabolites
mre01120  Microbial metabolism in diverse environments
mre01130  Biosynthesis of antibiotics
mre01200  Carbon metabolism
Module
mre_M00012  Glyoxylate cycle
mre_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mre00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    K649_04530
   00620 Pyruvate metabolism
    K649_04530
   00630 Glyoxylate and dicarboxylate metabolism
    K649_04530
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    K649_04530
   00680 Methane metabolism
    K649_04530
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    K649_04530
Enzymes [BR:mre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     K649_04530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: AGK04208
UniProt: D3PQL0
LinkDB All DBs
Position
complement(899325..900314)
Genome map
AA seq 329 aa AA seqDB search
MKPPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEITPALKALGGVIMELEDC
AFPTLAGIVATDDPNIAFGDADYALLVGAMPRKQGMERADLLQANGAIFTAQGRALSENA
RKHVKVLVVGNPANTNALITYKNAPNLSPRQIHAMTRLDHNRAISQLAARLKVPVSEIKK
MTIWGNHSLTQYPDLFHCEVGGRNAYELVGDHDWYANTYIPKVAKRGAEIIEARGASSAA
SAASAAIDHMRDWALGTPAGDWVSMAIPSDGSYGIPEGLVYSYPCVCKDGDFEIVQGLEI
NEFSRSKMDASAKELADERDAVLQLGLIK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccccctgtacgtgtggcagttaccggtgcagccggtcagattggctatagtctg
ctgttccgcattgctgcgggtgagatgctgggcaaagaccagccggtgattctgcaactg
ctggagatcaccccggccctcaaggccctgggcggggtgattatggagctcgaggactgc
gccttccccaccctggccggcatcgttgccaccgacgaccccaacatcgctttcggcgat
gccgattacgctttactggtcggggccatgccccgcaagcaaggcatggagcgcgccgat
ttgctccaggccaacggcgccatctttaccgcccagggccgggccctctccgagaacgcc
cgcaagcacgtcaaggtgctggtggtgggcaaccccgccaacaccaacgccctcatcacc
tacaaaaacgcccccaacctctcgccgcgccagatccacgccatgacccgcctcgaccac
aaccgggccatctcccagctcgccgcccggcttaaggtaccggtcagcgagatcaagaag
atgaccatctggggcaaccactccctcacccagtaccccgacctattccactgcgaggtg
ggcgggcgaaacgcctacgagctggtaggcgaccacgactggtacgccaacacctacatc
cccaaagtggccaagcgcggcgcggagattatcgaggcccgcggggcttcctcggcggcc
tcggcggccagtgcggccattgaccacatgcgcgactgggccctgggcaccccggcgggc
gactgggtgagcatggccatcccctccgacggttcgtatggcattcccgaggggctggtg
tacagctacccctgcgtctgcaaagacggcgactttgaaatcgtgcagggcctggagatc
aacgagttcagccgcagcaagatggacgccagcgccaaagagctggccgacgagcgcgac
gcggtgttgcagttggggctcatcaagtaa

DBGET integrated database retrieval system