KEGG   Mycobacterium rhodesiae: MycrhN_0266Help
Entry
MycrhN_0266       CDS       T01685                                 

Definition
(GenBank) acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II
Organism
mrh  Mycobacterium rhodesiae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(261800..263479)
Genome map
AA seq 559 aa AA seqDB search
MISRPKSIVDVVFDRSASDGLAYVFLADGTSESEVRWTFSDTANKARAFAAHLRDRGIGA
GDRVVLAVNPSLDYIAALYGIMKLGAVPVPCFPPLRSKELDRFHAITVDCAPKAIVIDQM
YREPIEALQVRLQSSNLEPAIVYAEQVPETADASESVSTALNEVALIQYTSGSTGAPKGV
CLTHENLVSNCEALGRNMGDDPARVGFSWLPPYHDMGLMGTIFISMFQGVPLVLMSPMHF
VQEPFRWLKAISDYRVSITVGPNFSLDMLSDALSDNAVEGIDLSTVERLYCGAEPISANT
LERFLRAAEPLGFDPAALTPCYGMAEATLYVSGKQGGTSYRVGSSPEPSEAHRPIVSCGE
VDSEHVVRIVDPTSLERLNDGHVGEIWVSGPSVAAGYHERPEQNRQVFTAKLADDEGAYL
RTGDLGFLRAGELFVTGRIKDLVIVNGRNIYPQDVEGVVRAHPDLRLAVAFSVPNDSTEQ
LCVVAETGHREVSAQLHSTMSEAIRSSVISEFGIRPHVHIAPKRAIPTTTSGKVRRQETR
RMFLANELPSVPAVQECTA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctcgccccaagagcatcgtcgacgtcgtgttcgaccgatcggcgtccgatggc
ctggcgtacgtgtttcttgccgacggcacctcggagagcgaagtccggtggacgttctct
gatacggcgaacaaggcgcgcgcattcgccgcccacctacgggatcgagggatcggcgcc
ggcgaccgcgtcgtactcgccgtgaatcccagcctcgactacatcgccgcgctgtacggg
atcatgaagctcggtgccgtcccggtgccatgtttcccgcctctgcggtccaaagagctg
gaccgattccacgcgatcacggtcgattgcgcgcccaaggcaatcgtgatcgaccagatg
taccgcgaaccgatcgaggcgctgcaggttcgactccagtcctcgaacctcgagccggcc
atcgtatatgccgagcaggtgccagagaccgccgacgcatcggaatcggtgtcgaccgca
ctcaacgaggtcgcgctcatccagtacacgtccggctcgacgggagctccgaaaggagtt
tgtctcacgcacgaaaacctggtgagcaactgcgaagcgctgggccgcaacatgggtgac
gatcccgcgcgcgtcggcttctcatggttgccgccgtaccacgacatggggctgatgggc
acgatcttcatatcgatgttccagggtgtgcccctcgtcctgatgtcgcccatgcacttc
gtgcaggagcccttccggtggctgaaagccatcagcgactatcgggtgtcgatcaccgta
gggccgaatttctctctggacatgctgtcagatgcgctgagcgacaacgcggttgaggga
atcgatctatcgaccgtcgagcgactctattgcggcgccgaaccgatcagcgccaatact
ctcgagcggttcctccgtgccgccgaaccgctggggttcgacccggccgcgttgacaccg
tgctacgggatggccgaagcgacgctgtatgtctcgggtaagcagggcggaacgagctac
cgcgtcggctcgtcgccagaaccgtcagaagcccaccgccccatcgtcagctgcggcgag
gtcgacagcgagcacgtcgtgcgaatcgtcgatcccacgagcctcgagcgattgaacgac
ggtcacgtcggcgagatctgggtttcggggccgagcgttgccgccggctatcacgagcgg
ccggagcagaaccgtcaggtgttcacagcgaaactcgccgacgacgagggagcgtacctg
cgcaccggcgatctcggcttcctccgcgcaggtgaactgtttgtgactggccgaatcaag
gatctggtcatcgtcaacggccgaaacatctacccacaggatgtcgagggcgtagtccgc
gcacatcccgatctccgtctcgccgtggcgttttcggtcccgaacgacagcaccgaacag
ctgtgcgtcgtcgccgagaccggacatcgggaagtgtcagcgcagctgcactcgacgatg
tcggaggcgattcgctccagcgtcatttcggagttcggcatcaggccccacgtccatatc
gctccgaagcgcgccatcccgacgaccaccagcggaaaagtgcgccggcaggaaaccagg
cgcatgttcctggccaacgagttgccatccgtccccgcggttcaggagtgcacagcatga

DBGET integrated database retrieval system